KEGG   Aspergillus nidulans: AN2901.2Help
Entry
AN2901.2          CDS       T01016                                 

Definition
ARGI_EMENI Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ani  Aspergillus nidulans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AN2901.2
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AN2901.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AN2901.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 324 aa AA seqDB search
MTSPSTIKQRFLSKPNQLGVVAVGFNGGQCKLGVEAAPMALVEAGLLDQLRDDLDYEIHY
DNTVHYYEKEIPAEDPDHRGMKKPRAVSAVTETLSSQVYEHSKEGKFTLTLGGDHSIAIG
SISGIAKATRERLGREIGVIWVDAHADINIPEMSPSGNIHGMPMAFLTRLATEEKKDIFG
WLQEEHKVNLRKLVYIGLRDVDRGEKKLLREHGIKAFSMHDVDRHGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLISMDLVEVNPSLE
AVGASDTIRTGCSLVRSALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgccctcgactatcaagcagagattcctctccaagccaaaccagctcggcgta
gttgctgttggttttaatggcggccagtgcaagcttggcgttgaggcagctcctatggct
ctcgtcgaggccggccttctcgaccagcttcgcgatgatcttgactacgaaatacactac
gataacaccgtacactactatgagaaggagatccccgctgaagaccccgaccaccggggc
atgaagaagccgcgggctgtcagcgccgtcacagaaaccctcagctcgcaggtgtacgag
cactccaaggagggcaagttcacgctaaccctaggcggagaccactcgatcgcaattggg
agtatctccggcattgcaaaggcgacgcgcgagcggctgggacgggagattggtgtcatt
tgggtcgatgcgcatgctgatatcaacattcccgaaatgagtcccagtgggaatatccac
ggaatgccgatggcattcttgacgcggttggcgacggaggagaagaaggatatctttggt
tggttgcaggaggagcacaaggtcaacctccgcaagctggtgtatatcggactgagagat
gttgatcgcggtgagaagaagttgctccgggagcatggaatcaaggcgtttagcatgcat
gatgttgatcgccacggtattggtcgagtggtcgaaatggccctcgctcacatcggaaac
gacaccccaatccatctgtcctttgacgtggatgcactcgatccccaatgggcgcccagc
actggaacgccggtgcgtgggggtttgactcttcgcgagggagacttcatctgcgagtgt
gttcacgagacaggaaacttgatctccatggatttggttgaggtcaaccccagcttggaa
gctgtgggggcttccgacaccattcggaccggttgctcgttggtgcgtagtgcgttggga
gataccctgctctag

DBGET integrated database retrieval system