KEGG   Aspergillus nidulans: AN2927.2Help
Entry
AN2927.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ani  Aspergillus nidulans
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AN2927.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AN2927.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: Other group
  TTK family
   AN2927.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 828 aa AA seqDB search
MASPNSLSTAHATALHQQQYRQMSRASSVSRSGSRRSSPEVHNSVALRSNAASISKQYSA
GDSSDDEVPEPKFSASVKALLDEDDGNASPRLRTRGLNEYRPNLRVGSAASSNERRSRTT
SPLDQSNGSPAPRVVRIGSVLGSGSKLRREGSHLTSGENAEVEAEAKHYSSDFITPGPRT
RSVRISTSRTHTRSPTSASPSGRRSASRSPLHEEGSADRPEEEGKSRYDDYAPIIGTSSV
LRSRNPEDIGIQSSLRVKRVGRLTGTFLNGPARRGVLRRQSEEDQSPSYLSDSKEAEGGD
NNDYNYKSARASSPKVSWADPEQPQKTTDYRRISSGDGPFSRSSSPKSYVSHSKSTPGSS
SDASSKPSSSKEPIFKVPPPPTLPSTRDQENEPPPTFKRTKPQGFDFLDKPEKLSVVYGD
DKKDQELPAGTSPRKILSNRSNNTPHRPAPPPPKMSVLETATATGGAATASQSRKKRSQV
SINHKPFTRLDCIGRGGSSRVYRVMAENYKIFALKRVNLEDVDPTTLAGYKGEIDLLKKL
ENVDRVVRLFDWELNSDKRTLSVLMEIGESDLEKVLTYKLNAEDATFDINFTRFYWKEML
ECVQAVHEYNVVHSDLKPANFLLVQGRLKLIDFGIANAIQDNTVNVHREQQVGTPNYMSP
EALVDSNASLGLPASVGKMMKLGKPSDVWSLGCILYKMVYGQPPFAKIAKYYERIMAIPN
PKVKIDFPAFGVGGIQVPPGLIRTLKGCLQRDQTLRPTISDLLGQRDPFLYPDAQLEGAV
PITQDVLGRILVNVVNHCRVRGVPNDEELAAWPAGFFAKIKAALEENP
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccgaattctctctctaccgcccatgcgacagctttgcatcaacaacaatac
cgacagatgtcccgcgcctcctctgtctctcgctctgggtccaggcgctcttcacctgag
gtccacaattctgttgctctccgaagcaacgctgcatcaatatcaaagcaatactctgcc
ggcgacagctccgatgacgaagtaccggagccgaaattcagcgcgtctgtcaaggctctt
ctcgacgaggacgacggaaatgcttcaccccgtctgcggaccaggggcctaaacgaatac
cggccgaatttgcgtgtaggatcagctgcgtccagcaatgagagacgatcccgaaccact
tcgccgctggatcaatcgaacggaagccccgccccacgcgttgttcgcataggatctgtc
ctcggcagtggctcaaaattgcgaagagaaggatcgcatctaactagtggggaaaatgcg
gaggtggaagcagaggcaaaacattattcaagtgatttcatcaccccaggtcctaggaca
cgcagtgttcggatcagtacgtcgcgtactcacacacgatctcccacatccgcatcaccg
tctggaaggcgatcggctagccggagccctcttcacgaagaaggaagcgcagatcgccct
gaagaagaagggaagtccagatatgatgactacgcgccgatcattggaacgtcatccgtg
cttcgttcacgcaacccagaagacattggcattcagagttccttgcgtgtgaaaagagtc
ggcaggttgacgggcacatttctcaacgggcccgccagacgcggtgtgctgagacgccag
agtgaggaggatcaatcaccaagctatctctccgactctaaggaagccgaaggcggtgat
aacaatgactataattacaaaagtgcgagggcctcgtctcccaaagtatcatgggcagat
cccgagcaaccacagaagactacagactatcgccgcatttcgtccggtgacgggccattc
tcaaggtcctcttcgccgaagtcatatgtgtcacactccaaatccaccccgggatcatct
tctgatgcctcctcaaaaccttcaagctcgaaagagcctatatttaaagtacctcctccc
ccgacattaccatccacccgtgaccaagagaatgaacctccaccaacgtttaagcgaacc
aagccacagggattcgattttctagacaaaccggagaaactttcggtggtttacggcgat
gacaagaaggaccaagagcttccagcagggacatcgccaaggaagatactttctaatcgg
agtaacaacacacctcatcgacccgcgccccctcctcctaagatgtccgtgttagaaacc
gccactgccacgggaggagcagctacggcatctcagtcgcgcaaaaagcgtagccaagtt
tcgattaatcacaagccattcacccgcttggattgcatcggtcgtggaggtagctcgcga
gtttaccgtgtaatggcagagaactataagatctttgctctaaagcgtgtaaatttagag
gatgtcgatccgacgaccttggctggctacaagggggagattgatcttcttaagaaactg
gaaaacgttgaccgtgtggttcgcttgtttgactgggaattgaactcggacaagcgcact
ctcagcgtgctcatggagattggcgagtcggacctggaaaaggttctgacgtataaactg
aatgctgaggatgccacttttgatatcaacttcacccggttctactggaaggagatgctg
gaatgtgtccaggcggttcatgaatacaatgtcgtccattccgacttaaaacccgccaat
ttccttctcgtccaagggagactaaaactgatcgattttggaattgccaacgccatccaa
gacaatactgtcaatgtacaccgcgagcagcaggttgggactccaaactatatgtcccct
gaagcgctggttgactcaaatgcctctctgggtttaccagcaagtgttggcaagatgatg
aagcttggcaaaccgagtgatgtatggagtctgggctgtatactgtacaagatggtctac
gggcagcctccttttgcaaagattgccaagtactacgagcgcatcatggcaattccgaat
ccgaaagtgaagattgattttccagctttcggggtcggcggcatccaggtgcctccagga
ctcatacggactctgaaagggtgtctgcaacgagatcagacactgcgaccgactatcagc
gacctcttgggtcaacgggacccattcctgtaccccgacgcacagcttgagggcgccgtc
cccatcacccaggatgtcctgggcagaattttggttaacgttgtgaaccattgcagagtc
cgcggcgtgcccaacgacgaagaactggctgcctggccagctggcttttttgcaaagata
aaagcagctttggaagagaatccctaa

DBGET integrated database retrieval system