KEGG   Aspergillus nidulans: AN3003.2Help
Entry
AN3003.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ani  Aspergillus nidulans
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AN3003.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AN3003.2
Peptidases [BR:ani01002]
 Metallo Peptidases
  Family M67
   AN3003.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 544 aa AA seqDB search
MASLSPAQSGGASAPQSVEKISRLAQDYKFNPAVPLRYWLRTAATLVREARIYLREGHDE
QAYLLLFRHAQLVLVHLADHPDLKDGKDVREERKALIAAEKEVKQNLEILEKLKPRINKR
YERHTQLMRERQSRMSSSAAVSPAASSQPSPPPDPALSGVAEPLEAGKDNELAVKLARTE
ISRRATVRNAMRQGGLSGEDDSSRRAAGIWGDWEEALQRNERRDPDDLSRRIQEVRLNLE
GRPQISSKSVTRPLADVSSTPTYKYPTVPRQKALDVPSVPVDIPKTEARELTKPPVLPPK
ESFQTSQPSGLELPPRPDKISQAVPPASAAAVPTKVPGDDKRKGLDPSSFTFKPSAYLEN
GTPLRTVFLPPQLRSHFLSLAASNTRKNLETCGILCGTLISNALFISRLLIPEQISTSDT
CETVNESAIFDYCDSEDLMVLGWIHTHPTQTCFMSSRDLHTHCGYQVMLPESIAIVCAPS
QTPNWGVFRLTDPPGLKSVLSCTQTGLFHPHAETNLYTDALRPGHVFEANGLEFETVDQR
VNKS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctatccccagcccagagcggaggcgcttccgcacctcaaagtgtggagaag
atcagccgtttagctcaggactacaaattcaaccctgcagttcccttacggtactggctg
aggacggctgctaccctagttcgtgaggctcgaatctacctgcgcgaaggacatgatgaa
caggcatacctcctcctcttccgacatgctcaattagtgcttgttcatttagccgaccat
ccagacttgaaggatgggaaagatgtgagggaagaacggaaggctctaatagcggctgag
aaggaggtgaagcagaatctggagatcctggaaaaactgaagccgcggatcaacaagcga
tatgagcggcatacacagttgatgcgtgaacgccagtcccgcatgtcctcgtccgctgcg
gtcagtcccgctgcgtcgagccagccgtcgccacctccggaccccgctctgtctggtgtt
gccgaacctctagaagctgggaaggataatgagctagctgtcaagctggctcggaccgag
attagtcgaagggcaaccgtcaggaacgcgatgcgccaaggtggactcagcggtgaggat
gattcgagccgacgcgcggcagggatatggggtgactgggaagaagctctgcagcgaaat
gagaggagggatcccgacgatctgagtcgacgcattcaagaagtgcgactgaacctggag
ggcaggccacagatttcaagcaagtctgtaacgcggccgctggccgatgtctcatctacg
cccacttacaaatatccaactgttcctcggcagaaagcgcttgatgttccctctgttccg
gtggatattccaaagaccgaggcccgcgagctcaccaagccaccggtacttcctccgaaa
gagagctttcaaactagccagccaagcgggcttgagcttccgccgcgtccggacaagatt
tcacaggcagttccaccagcatctgcagcagcagtgcctacgaaagtgccaggggacgac
aaacgcaagggattggacccctccagcttcacattcaagccatccgcctaccttgaaaac
gggacgcctcttcgcaccgtctttcttccaccacagttgcggtcacattttctgtcgctc
gccgcgtcaaatactcgtaagaatttggaaacgtgcggtattctctgtggtacactgata
tctaacgccctctttatttctcgacttcttatccccgagcagatatctacatcagacacc
tgcgagacagtcaacgagtccgccatttttgattactgcgactcggaagatctaatggtg
cttggctggatccatacgcaccctacccagacctgcttcatgagctcaagggacttgcac
acacattgcgggtatcaagtcatgctaccggagagcattgccatcgtttgcgcgccgagt
cagaccccaaactggggtgtattccgtttgacggaccctccagggctcaagtcggtcctg
agctgtactcagaccggactgttccatcctcatgctgagaccaatctatacacggatgcg
ttgcgcccagggcatgtttttgaggctaatgggttagaattcgagactgttgaccagcgg
gtgaacaagtcatga

DBGET integrated database retrieval system