KEGG   Aspergillus nidulans: AN3184.2Help
Entry
AN3184.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN3184.2
   00052 Galactose metabolism
    AN3184.2
Enzymes [BR:ani01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AN3184.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 447 aa AA seqDB search
MLLPGKLQLRDHLRFLVCPARFSARVLLLYCYIFIGVLALLTYTMYVKQSLPAFVLGLVA
SSQNVAALPQASAATPSPVADPYKIYTISAGNITAKLIPHGARLTQLLVPDRDGILQDVV
VGFDDPTQYSDDDNFYGPVVGRYANRIRNGTFTIAGETYHTPKNENDGLDTLHGGEVGYD
KRNWTVTSYTNSSITFSFYDHALQGFPGDVLTHATYTVDNNNPSGLPQLTTKLVSLALTE
ATPIMLANHIYWNLNAFREPNVLEDVTLQLPLSTRFIATDGILIPNGTIATVDAYNGAPD
FTSPKLVGQDIKNAVGLCGTDCTGYDNCWLIDRPTGYSSDALIPALYMASKNTGITLEVA
TNTPAIQIYSCNGQDGSDPVKPSQIQRAKQAGYNGPTTVDKNACVVVETEGWIDGINQPG
WGQTDNQIFTPGGLPAVNLAVYKFGTA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgcccgggaagctgcagctccgcgatcaccttcggttcctcgtctgtcctgcg
cggttctctgcacgcgtcttactcctttactgctacatcttcattggagtcctcgcgctc
ctcacctacactatgtacgtcaaacaatctctaccggcctttgtcctgggtctagtcgcc
tcttcgcagaacgtcgccgctctaccgcaggcaagcgcggcgaccccaagtccagtcgcg
gacccgtataagatctacaccatcagcgccggcaatatcacggccaagcttatcccgcac
ggcgctcgtttgactcaattgctcgttcccgaccgcgatgggatactgcaggacgtcgtt
gtaggcttcgacgacccaacccaatacagtgacgacgacaacttctacggcccagtcgtc
ggccgctacgcgaaccgtatcagaaacggcactttcaccattgctggcgaaacatatcat
acccctaagaacgagaacgacggccttgatacgcttcacggcggcgaggtcggctacgac
aagcgcaattggacggtgacctcctacacgaactcatcgataacattctctttctatgac
catgcgctacagggcttccctggcgacgtcctcactcatgcaacgtacaccgttgacaac
aacaacccgtcgggtctccctcagctcaccaccaaactcgtctcccttgccctaaccgag
gcaactcccatcatgctcgcaaaccacatctactggaacctcaatgctttccgtgagccc
aacgtcctcgaagacgtcaccctccaacttcctttgagcacgcgcttcatcgccacggac
ggtattctcattcccaacggcacaattgctaccgttgacgcttacaatggcgctccggac
ttcacgtccccgaaactagtcggtcaggacattaagaacgccgtcggtctctgtggcact
gactgcacgggctacgacaactgctggctcatcgacagaccaacagggtactcctctgac
gcgctaattccagctctctacatggcctccaagaacactggcattacccttgaggtcgcc
acaaacacccccgccatccagatctactcctgtaatgggcaagacgggtctgacccagta
aagccgtctcaaattcagcgcgccaagcaggccggctacaatgggccgactacagtcgac
aaaaatgcctgcgttgttgtcgagactgagggatggattgacggtatcaatcagcctggg
tggggacagacggacaaccagatctttacccccggtggcctgcctgccgtcaatctggct
gtttacaaatttggaacggcttag

DBGET integrated database retrieval system