KEGG   Aspergillus nidulans: AN3201.2Help
Entry
AN3201.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ani  Aspergillus nidulans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AN3201.2
  Lipid metabolism
   00600 Sphingolipid metabolism
    AN3201.2
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AN3201.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AN3201.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 1030 aa AA seqDB search
MPESSSANDWENPRVFQRNRLKARAYWIPETSLLLNGDWDFNYVSSPLLAPSPTPSRLSG
DGGEEKDAEQDQVEWKPIPVPGHWQLHGYGRPNYTNVIFPFPVDPPRVPSENPTGTYKRS
FRVPSTWDRDAQLRLRFDGVDSAYHVWVNGVQVGYAQGSRNPAEFDISDQVDREKENEVF
VRVYQWCDGSYIEDQDQWWLSVSRIEDFRVTTTLDSEYHDAELHLAVDIASTEASTLHVE
LFDRASNGTLATEDKEIVGTGTYKLSLSVRNPRKWTAETPFLYDLEIALATRYDPSAILQ
KVHHRVGFRQVEIKNGNITVNGVPVLFRGVNRHDHHPLHGRAVPLDFVKEDLLLMKRHNI
NSVRCCHYPSTPQLFSMCDELGLWVMDEADLECHGFYDAVARPLDIPESMDYEERKKLTF
AQAAEFTSNNPEWKAAYLDRAEQMVARDRNYASVVIWSLGNEAFYGANHAAMYRFIKEED
PTRPVHYEGDMEAKTADMYSFMYPSVDRITRLATEEGDAFTKPIVLCEYGHAMGNAPGGL
AEYMNAFRTYRRLQGGWIWEWANHGLWLEEKGFYAYGGDFGDQPNDGSFVLDGLLYSNHT
PTPGLVELRKAYEPIHAWYEDGRIRLQNRFDFAGLEGVQAGYRVEVLGEGMELIEAGTLE
IPALRAGETGEIPFPSSFPSKATAGGETWLTVSFTTKHATPGLDANYEIAWFQHRLGSTA
PSLPALTPAASFPIQTHSTKADHIITGADFTITFSRTTGLLTSWRIHSREILADSTSAGL
TLGFWRPPTDNELPYDLGEWRRYGLDTLTSSLRKISLTEVDESMLEIRTEAYVSPPILAW
GFEAETVYRITGDGALTVKAHVKPSGAKPVDVPRVGFDLVLADELDNASWFGLGPGESYA
DKKLSQKISIYSATTSELQTPYEVPQEGGNRMETRWLRLLNNRGRGVCVTRDADGDEEQA
FQWVATRYSAESVERAKHPNELSPEKRVRVRLDVESAGVGTGACGPRTLEQYRVPCAERR
FGFRIAPWTK
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaatcatcgtctgccaacgactgggaaaaccccagagtttttcagcgcaatcgc
ctcaaggcccgcgcgtactggatcccagagacctcgctgctgctgaacggggattgggac
ttcaactatgtctcttcgccgcttttggctccttcgcctacaccgtcacgcttgagcggt
gacggcggcgaggagaaagacgcagaacaggaccaggtcgaatggaagcccatccccgtc
cctggtcactggcagctgcacgggtacggccggccaaactatacgaacgtcatcttcccg
ttccccgtggacccgccgcgggtgcccagtgagaatcccacggggacgtacaagcgcagc
ttccgtgtcccgtcgacgtgggatagagatgcacagctgagactgcgattcgacggagtg
gacagcgcgtaccatgtctgggtgaacggggtgcaggtcgggtatgcgcaggggagtcgt
aaccctgcggagtttgatatctctgatcaggttgaccgcgagaaagagaacgaggtattt
gtcagggtataccagtggtgcgatgggagctatatcgaggatcaggatcagtggtggctg
agtgtctctcgaatcgaggatttccgggtgacaacgaccctggacagcgagtatcacgac
gctgagctccacctcgccgtcgacatcgcctcgacagaggccagcacgctccacgtcgag
cttttcgaccgcgccagcaacggaaccctcgcgacggaggataaagagattgtcggcaca
gggacatacaagctcagcctgtccgtacgcaatccgcgcaaatggaccgctgagacaccc
ttcctctacgatcttgagatcgccctggcgacgaggtacgacccatccgccatcctacaa
aaggtgcaccaccgcgttggattccggcaggtcgagatcaagaacggcaatatcactgta
aatggggtccctgtcctctttcgtggcgtcaaccgacatgatcaccatcctcttcacggg
cgtgccgtgcccctggactttgtcaaggaggacctcctcctcatgaagaggcacaacatc
aattcggtccggtgctgccactacccatccaccccacagctcttctccatgtgtgacgag
ctggggctgtgggtcatggacgaagcagaccttgagtgccatgggttctacgatgccgtg
gcccggccgctcgatataccggaaagcatggactacgaggaacggaagaaactcacattc
gcgcaagcggccgagttcacgtccaataaccccgaatggaaagcagcgtatctggaccgt
gcggagcagatggtagcaagggacaggaactatgcctccgttgtcatttggagtctgggg
aacgaggccttttacggggccaaccacgcggccatgtaccgcttcataaaggaagaagac
ccgacccgtcctgtgcattacgagggggatatggaggccaagacggcggatatgtactcg
ttcatgtatccttctgttgatcggatcactaggctcgcgacggaagaaggggatgcattc
accaagccgatcgttctctgcgagtacggacacgcgatggggaacgcacccggcggcctg
gccgagtacatgaatgcgttcaggacctatcgccggctgcagggaggctggatctgggag
tgggcaaaccacgggctctggctggaggagaaggggttctacgcgtacgggggtgacttc
ggcgaccagccgaacgacgggagttttgtgctggatggcttgctttacagcaaccatacc
cctacgccggggctagtcgagctgagaaaggcgtacgagccgatccatgcgtggtatgaa
gatggtagaatccggctgcagaaccggtttgattttgccgggcttgagggcgtacaggcg
ggatatcgggtcgaggtgctgggcgaaggcatggagctcatcgaggccggtactctggag
ataccggctctccgggccggagagacgggggagatccccttcccttcctccttcccgtcc
aaggcgacggcagggggcgagacgtggctgaccgtctcgttcacgacaaaacacgcgaca
ccgggactggatgcaaattatgagatcgcctggttccagcaccgtcttggctcaacggcc
ccgtctctgcctgcgttgacgccggcagccagcttcccaatccagactcactccacgaag
gccgaccatatcataaccggcgcagacttcaccatcaccttctcacgcacgaccggcctg
ctgacgagctggcgtatccatagcagagagatcctcgccgactccacatcggccggactg
accctgggcttctggcgcccaccaacggacaacgagctcccgtacgatctgggcgagtgg
cgccggtacgggctagatacgctcacctccagcctccgaaagatctcgctgaccgaggtg
gacgagtccatgctcgagatccgcactgaggcgtacgtttcgccgcccatcctggcctgg
ggattcgaggcggaaacggtctaccgcatcaccggcgacggcgccttgactgtcaaggca
cacgtcaagcccagcggcgcaaagccagtcgacgttccccgagtcgggttcgacctcgtc
cttgcagacgagctggacaacgcctcctggttcggcctgggcccgggagaatcttacgcc
gacaagaagctgtctcagaagataagcatctattctgcaacaacgtcggagctgcagaca
ccctatgaagtgccgcaagagggcggaaacagaatggagacgcggtggctgcgattgctc
aacaaccgcggccgaggtgtttgcgtcacccgtgatgcagatggagacgaggagcaggca
ttccaatgggtcgcgacgcggtacagcgccgagtctgtcgaacgtgcaaaacacccaaac
gagctctccccggagaagagagtccgcgttaggctcgatgtcgagagcgcaggagtcggg
actggagcttgcgggccgaggactctggagcagtaccgggtgccctgtgcagaaaggcgc
ttcgggttcagaattgcaccgtggactaagtga

DBGET integrated database retrieval system