KEGG   Aspergillus nidulans: AN3223.2Help
Entry
AN3223.2          CDS       T01016                                 

Definition
K6PF_ASPNG 6-phosphofructokinase (Phosphofructokinase) (Phosphohexokinase) (6PF-1-K)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AN3223.2
   01230 Biosynthesis of amino acids
    AN3223.2
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN3223.2
   00030 Pentose phosphate pathway
    AN3223.2
   00051 Fructose and mannose metabolism
    AN3223.2
   00052 Galactose metabolism
    AN3223.2
  Energy metabolism
   00680 Methane metabolism
    AN3223.2
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AN3223.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AN3223.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AN3223.2
Messenger RNA biogenesis [BR:ani03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AN3223.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 795 aa AA seqDB search
MAPTVATQPPPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIHSDCEAYAVYEGYEGLVEG
GDMIRQLHWEDVRGWLSQGGTLIGSARCMSFRERSGRLRAAKNMVLRGIDALVVCGGDGS
LTGADVFRSEWPGLLDELVKNGELTAEQVEPYRVLNIVGLVGSIDNDMSGTDATIGCYSS
LTRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMAAISTGADWLFIPEMPPKDGWED
IMCANITKNRRERGKRRTIVIVAEGAQDRNLNKITSDRVKDILTERLGLDTRTTILGHTQ
RGGAACAYDRSLSTLQGVEAVRAVLDMTPDSPSPVITIRENKIMRTPLMDAVKATQEVTA
HIKNREFEKAMLLRDSEFKEYHFAYLKTATPDHPKLSLTQEKRMRIAIVHVGAPAGGMNQ
ATRAAVTYCLTRGHTPIAIHNGFPGLIRHHADQPISSVREVKWQETDAWVNEGGSDIGTN
RGLPSEDYDEVARCFKEHKFDALFVVGGFEAFTAVSQLRQARDKYDAFKIPMVVLPATIS
NNVPGTEYSLGSDTCLNALIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGA
VAVYIPEEGIDIKMLARDIDFLRENFARDKGANRAGKIIMRNETASSTYTTQVIADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRIRALRMAIKCMMHLEGYAGKSKDEIANDEMSAT
VIGIKGSQVLFSVMGGEHGLEKVETDWARRRPKAEFWLQLQDTVNILSGRAGAKAMWTGY
EDESRTRPSSPAHLS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggccccaacagtcgcaactcaacctccccctcccaagcggcgccgcattggtgtcctc
acctctggaggagatgcccccggtatgaacggtgcagtacgagcggtggtccgcatggcc
attcactccgactgcgaagcttacgccgtttacgagggatacgaaggtctggtggaaggc
ggggacatgatccgacagctacactgggaagatgttcgtggatggctctcccaggggggt
acattgatcggatccgctcgctgcatgtcttttcgtgagagatctggccgtctccgcgcc
gctaaaaacatggtcctgcgcggaatcgacgcattggttgtctgcggtggtgacggtagt
ttgactggtgccgatgttttccgctctgaatggcctggtttattggacgagctggtgaag
aatggagaattgacggcagagcaggtcgagccgtacagagtcttgaacattgtcggtctc
gtgggctcaattgacaacgacatgtccggtacggatgccactattggctgctactcctcg
ttgactcggatctgcgatgctgttgatgacgtcttcgacactgcgttctcccaccagcga
ggcttcgttatcgaagttatgggccggcattgcggttggcttgctctgatggctgccatt
agcacaggcgccgactggcttttcattcctgagatgccccctaaggatggctgggaggat
atcatgtgcgcgaacatcacaaagaaccgtcgggaacgtggcaagcgcagaaccattgtc
atcgtcgccgaaggagcgcaagatcgaaacctcaacaagatcacaagtgatcgcgttaaa
gatattctcaccgagcgcctcggacttgacactcgtacaacaattctcggacacacccaa
agaggaggagccgcctgcgcctacgatcgatcgctatcgaccctgcaaggtgttgaggcc
gttcgtgctgttttggacatgacgccggactctccttccccagtgatcacgatccgcgag
aacaagatcatgcgcaccccgttgatggacgctgtcaaggccacgcaggaggttacagct
cacatcaaaaacagagaatttgagaaggcgatgttgttgcgcgactcagaattcaaagag
taccactttgcttatctgaaaactgccacacctgatcaccccaaactctccttgacccaa
gaaaagagaatgcgcattgccattgtccacgtcggtgccccggctggaggcatgaaccaa
gctacacgagctgccgtgacatactgtctcacccgtggccacactccgattgccatccac
aacggtttccccggcttgatccgccaccacgcagatcaacccatcagctcagtgcgcgaa
gtcaaatggcaagaaacagacgcgtgggtaaacgagggtggttccgacatcggcacaaac
cgcggtctcccgtctgaagactacgacgaggttgccaggtgcttcaaagagcacaagttc
gacgccttatttgtcgttggtggctttgaagccttcacggcagtgagccagctccgccaa
gctcgcgacaaatacgacgccttcaagatccccatggttgtcctgcccgccacaatctcc
aacaacgtcccgggcactgagtactccctcggcagcgacacctgcctcaacgccctgatc
gacttctgcgacgcaattcgccagtcagcctcctcctcccgtcgccgcgtcttcgtcatc
gaaacccagggcggtaaatcaggctacatcgctacaacagcagggttggccgtcggcgca
gtcgccgtatacatccctgaagaaggaatcgacatcaagatgctcgcccgagacatcgat
tttctccgcgagaactttgcccgcgacaagggtgccaaccgcgccggaaagatcatcatg
cgcaatgagactgcctcatccacatacaccacacaggtcattgctgatatgatcaaggag
gaagcaaagggccgcttcgagtcccgtgccgcagttcccggccacttccagcagggaggc
aagccctcgcccatggaccgcattcgcgcgctgcgcatggcaatcaagtgtatgatgcac
ctggagggctacgcgggtaaatcaaaagacgaaatcgcgaacgatgagatgtctgcaacc
gtcattggcatcaagggctcccaagtcctcttctccgtcatgggtggtgaacatggactc
gagaaggtcgagacggactgggcgagacggcgtcccaaggccgaattctggttgcagttg
caggatacagttaacatcttgtcgggacgggcgggggccaaagcaatgtggaccggttat
gaggatgagagccggacgcgaccttcgagtccggcacacttgtcatga

DBGET integrated database retrieval system