KEGG   Aspergillus nidulans: AN3223.2Help
Entry
AN3223.2          CDS       T01016                                 

Definition
K6PF_ASPNG 6-phosphofructokinase (Phosphofructokinase) (Phosphohexokinase) (6PF-1-K)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ani01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ani01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ani00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ani00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ani00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ani00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ani00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 795 aa AA seqDB search
MAPTVATQPPPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIHSDCEAYAVYEGYEGLVEG
GDMIRQLHWEDVRGWLSQGGTLIGSARCMSFRERSGRLRAAKNMVLRGIDALVVCGGDGS
LTGADVFRSEWPGLLDELVKNGELTAEQVEPYRVLNIVGLVGSIDNDMSGTDATIGCYSS
LTRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMAAISTGADWLFIPEMPPKDGWED
IMCANITKNRRERGKRRTIVIVAEGAQDRNLNKITSDRVKDILTERLGLDTRTTILGHTQ
RGGAACAYDRSLSTLQGVEAVRAVLDMTPDSPSPVITIRENKIMRTPLMDAVKATQEVTA
HIKNREFEKAMLLRDSEFKEYHFAYLKTATPDHPKLSLTQEKRMRIAIVHVGAPAGGMNQ
ATRAAVTYCLTRGHTPIAIHNGFPGLIRHHADQPISSVREVKWQETDAWVNEGGSDIGTN
RGLPSEDYDEVARCFKEHKFDALFVVGGFEAFTAVSQLRQARDKYDAFKIPMVVLPATIS
NNVPGTEYSLGSDTCLNALIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGA
VAVYIPEEGIDIKMLARDIDFLRENFARDKGANRAGKIIMRNETASSTYTTQVIADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRIRALRMAIKCMMHLEGYAGKSKDEIANDEMSAT
VIGIKGSQVLFSVMGGEHGLEKVETDWARRRPKAEFWLQLQDTVNILSGRAGAKAMWTGY
EDESRTRPSSPAHLS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggccccaacagtcgcaactcaacctccccctcccaagcggcgccgcattggtgtcctc
acctctggaggagatgcccccggtatgaacggtgcagtacgagcggtggtccgcatggcc
attcactccgactgcgaagcttacgccgtttacgagggatacgaaggtctggtggaaggc
ggggacatgatccgacagctacactgggaagatgttcgtggatggctctcccaggggggt
acattgatcggatccgctcgctgcatgtcttttcgtgagagatctggccgtctccgcgcc
gctaaaaacatggtcctgcgcggaatcgacgcattggttgtctgcggtggtgacggtagt
ttgactggtgccgatgttttccgctctgaatggcctggtttattggacgagctggtgaag
aatggagaattgacggcagagcaggtcgagccgtacagagtcttgaacattgtcggtctc
gtgggctcaattgacaacgacatgtccggtacggatgccactattggctgctactcctcg
ttgactcggatctgcgatgctgttgatgacgtcttcgacactgcgttctcccaccagcga
ggcttcgttatcgaagttatgggccggcattgcggttggcttgctctgatggctgccatt
agcacaggcgccgactggcttttcattcctgagatgccccctaaggatggctgggaggat
atcatgtgcgcgaacatcacaaagaaccgtcgggaacgtggcaagcgcagaaccattgtc
atcgtcgccgaaggagcgcaagatcgaaacctcaacaagatcacaagtgatcgcgttaaa
gatattctcaccgagcgcctcggacttgacactcgtacaacaattctcggacacacccaa
agaggaggagccgcctgcgcctacgatcgatcgctatcgaccctgcaaggtgttgaggcc
gttcgtgctgttttggacatgacgccggactctccttccccagtgatcacgatccgcgag
aacaagatcatgcgcaccccgttgatggacgctgtcaaggccacgcaggaggttacagct
cacatcaaaaacagagaatttgagaaggcgatgttgttgcgcgactcagaattcaaagag
taccactttgcttatctgaaaactgccacacctgatcaccccaaactctccttgacccaa
gaaaagagaatgcgcattgccattgtccacgtcggtgccccggctggaggcatgaaccaa
gctacacgagctgccgtgacatactgtctcacccgtggccacactccgattgccatccac
aacggtttccccggcttgatccgccaccacgcagatcaacccatcagctcagtgcgcgaa
gtcaaatggcaagaaacagacgcgtgggtaaacgagggtggttccgacatcggcacaaac
cgcggtctcccgtctgaagactacgacgaggttgccaggtgcttcaaagagcacaagttc
gacgccttatttgtcgttggtggctttgaagccttcacggcagtgagccagctccgccaa
gctcgcgacaaatacgacgccttcaagatccccatggttgtcctgcccgccacaatctcc
aacaacgtcccgggcactgagtactccctcggcagcgacacctgcctcaacgccctgatc
gacttctgcgacgcaattcgccagtcagcctcctcctcccgtcgccgcgtcttcgtcatc
gaaacccagggcggtaaatcaggctacatcgctacaacagcagggttggccgtcggcgca
gtcgccgtatacatccctgaagaaggaatcgacatcaagatgctcgcccgagacatcgat
tttctccgcgagaactttgcccgcgacaagggtgccaaccgcgccggaaagatcatcatg
cgcaatgagactgcctcatccacatacaccacacaggtcattgctgatatgatcaaggag
gaagcaaagggccgcttcgagtcccgtgccgcagttcccggccacttccagcagggaggc
aagccctcgcccatggaccgcattcgcgcgctgcgcatggcaatcaagtgtatgatgcac
ctggagggctacgcgggtaaatcaaaagacgaaatcgcgaacgatgagatgtctgcaacc
gtcattggcatcaagggctcccaagtcctcttctccgtcatgggtggtgaacatggactc
gagaaggtcgagacggactgggcgagacggcgtcccaaggccgaattctggttgcagttg
caggatacagttaacatcttgtcgggacgggcgggggccaaagcaatgtggaccggttat
gaggatgagagccggacgcgaccttcgagtccggcacacttgtcatga

DBGET integrated database retrieval system