KEGG   Aspergillus nidulans: AN3390.2Help
Entry
AN3390.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ani  Aspergillus nidulans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AN3390.2
   00500 Starch and sucrose metabolism
    AN3390.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AN3390.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 325 aa AA seqDB search
MRVQSYLSLFSLVGAALCAPREHFKRTARTSAPAGCLTVGGSGTYSTIGAAFAALGSSSS
EACIYISAGTYKEQLTFQYAGPLTLYGETTDTSSYKKNTVTITHTISSPEAGSLVASATV
NAAMDNFTMYNINVVNGYGKGAQAVALAASGERQGYYGCQFLGYQDTLYARVGVQYYSNC
YIEGAVDYIFGDASAWFGECDIVSNGAGYITAMSRETASDPAWYCFDHCNIYGKSGLDLT
GDVYLGRPWRVLARVIYQNSELSDIINAAGWTTMAEGATPLYYEIGNTGDGADTSKRLYL
SEISAAVTKATVLGSDWTDWLDWSY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttcaatcatacttgtcgctcttcagccttgttggcgcagctctctgcgcgcct
cgtgagcacttcaagcgcactgccagaacgtctgctccggccggctgtctcaccgttgga
ggaagcgggacctactcgacgatcggcgctgcgtttgcagctttgggctcatcctcgtct
gaggcctgcatctacatatcagccgggacctacaaggagcaattgaccttccaatacgct
gggccgttgaccctctatggcgaaaccacggacacgagcagttacaagaagaacaccgtc
acgataacccatacgatttcctcacctgaagcagggtcccttgttgcgagtgcgactgtc
aatgcggccatggataactttaccatgtacaacatcaatgttgtgaatgggtacgggaag
ggggctcaggctgtcgcactggctgccagcggagaacgccagggttactatggctgccaa
ttccttgggtatcaagatacgctgtacgcacgcgtgggcgtgcagtactactccaactgc
tatattgagggggccgtagactacatattcggcgacgcaagcgcctggttcggcgaatgc
gacatcgtctccaacggtgcaggctacatcaccgccatgtcgcgcgagacagcctccgat
ccggcctggtattgcttcgaccactgcaatatctacggaaaatcggggctggacttgacc
ggcgatgtatacctcggacggccgtggcgcgtcctcgcgcgggtcatctatcagaactcg
gagctgagtgatatcatcaacgcggctggatggacgactatggcagaaggagccacgcca
ctgtactacgagatcgggaatacgggtgacggggcagacacgtccaaaaggctgtatctt
agcgagatcagtgcggctgtcaccaaggctacggtgctggggagcgactggacggactgg
cttgactggagctattga

DBGET integrated database retrieval system