KEGG   Aspergillus nidulans: AN3411.2Help
Entry
AN3411.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  
translation initiation factor 4E
Organism
ani  Aspergillus nidulans
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AN3411.2
Messenger RNA biogenesis [BR:ani03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AN3411.2
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AN3411.2
Translation factors [BR:ani03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AN3411.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 244 aa AA seqDB search
MAAVAENAPPVTNENTAPPAVAVEEKTEKANGDIVTVFHDPENFNVKHPLMHEWTLWFTK
PPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELGLKADYHLFKKGVRPEWEDPQN
KHGGKWSFSFKDKRSVPIDDLWLHAQLAAIGETLENDGDNEVMGVVVNVRKGFYRVGLWT
RTVGKTLPGDKSGRTPAQGKEVLESIGRRFKEVLRLGPNDSVEFSGHTDSAHSGSTRAKA
KYTV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcgcagagaatgctcccccggtgacgaacgagaacacggcccctcctgcc
gttgcagttgaagagaagaccgagaaggccaacggcgacatcgtcacggtcttccacgac
ccagagaacttcaacgtaaagcatcccctgatgcacgaatggactctttggttcacaaag
cctcctagtggaaagggcgacaactggaacgatctgctgaaggaggttgtgaccttcaac
tctgtagaggaattctggggcatttataacaacataactccgacctctgaactaggcctt
aaggcagactaccaccttttcaagaaaggtgttcgccccgagtgggaagacccgcagaac
aagcacggcggcaagtggtcattctcgttcaaggataagcgatcggtccctattgatgat
ctttggctgcacgcacagctggcggccatcggcgaaaccctcgagaatgatggcgataat
gaagtcatgggtgtcgttgtgaacgtgcgtaagggtttttaccgtgtcggtctctggaca
cggactgttggcaaaacccttcccggtgacaagagcggacgcacacccgctcagggtaag
gaagtgcttgagtcaatcggccgccgcttcaaggaagtactccgtcttggtccaaatgac
agtgttgaattctcgggacacacggatagcgcccacagtggcagcacaagagccaaggcc
aaatacactgtttaa

DBGET integrated database retrieval system