KEGG   Aspergillus nidulans: AN3422.2Help
Entry
AN3422.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ani  Aspergillus nidulans
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AN3422.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AN3422.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AN3422.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 539 aa AA seqDB search
MADQFKARTLKRKNVKGLALNAAPKSTSTLSNGDSQVPGAAGNGESNRTDTLEIGLEFRL
DLRSEDLITLKELGAGNGGTVSKVMHASTKVVMARKIIRVDAKENVRKQILRELQVGHDC
NSPNIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPIRVDVLGKITESILAGLVYL
YEAHRIMHRDIKPSNVLVNSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGAY
TVRSDVWSVGLTVMELAVGRFPFDTTDSAAGDRASAGPMGILDLLQQIVHEPAPKLPRSD
AFPPVLHEFVAKCLLKKSEERPTPLELYEKDAFLAAAKRTPVDLQEWAISMMERHNRKSY
LAPPAPKSLKETRESPSPAQAPSPVQKHGTSRPSRGTTGEIPLNVARDSSSHQRQHAPQS
QSHFSSNPSHYSSNSSHYSSRSSRSSPPISLEHLSLESKQDEHRPTRRPSRTPLGDSSSS
LDQSLRPSIGSRSASSHNTNSRMPLQSTALPFRVAPTPGGYPTPNSTSWQRRGDHMGAL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaattcaaagcgcgaaccttgaagcgtaaaaacgtcaagggtcttgccctg
aacgcagctccgaagtctacgtcgactttgtctaatggcgattctcaggttcccggcgcc
gctggcaacggcgaaagcaaccgcactgataccctggagattggtttggagttcaggttg
gatttgcgcagcgaggacctgattaccctgaaagaactcggtgccggaaatggagggacg
gtctctaaagtcatgcatgcttcgaccaaggtcgtcatggctcggaagattattagggtc
gacgcaaaagaaaacgtcaggaagcagattctgcgggagcttcaggtgggtcacgattgc
aactctccaaacatagtgaccttctatggagcgtttcaaaacgaagcaagagatattgtg
ttgtgcatggaatatatggattgtggttcacttgatcggatttccaaagacttcgggccc
atccgtgtggatgttttgggaaaaatcacagagtcgattctggcgggccttgtctatctt
tatgaagcccatcgtatcatgcatcgcgatataaaaccatccaatgtccttgtgaactct
cgaggcaacatcaagctgtgcgactttggagtcgcaactgaaacagtcaactctattgcg
gacacgtttgttggcacttcaacttacatggcccccgaacgtattcaaggcggtgcctat
actgttcgctcggatgtttggagtgtaggtttgacagtcatggaattggctgtcggcagg
tttcctttcgatacgacagattccgctgctggagaccgagccagcgcgggacccatgggt
attctggatcttctccagcagattgtccacgaacccgctcccaaactgccaaggagtgac
gccttcccgccggttctgcatgagtttgtcgcaaaatgtctactcaaaaaatctgaggaa
cgaccgacgccccttgagctatatgagaaggacgcattccttgctgccgccaaacggacc
ccagtcgacctccaagagtgggctatcagcatgatggagcgacataaccggaagtcttac
ttagcacccccagcgccgaaatcactcaaggagacaagagagtctccatcgcctgcccaa
gccccatcgcccgtccaaaaacacggtaccagcaggccatcccgcggcacaaccggggaa
attcctctcaatgtagctcgcgacagctcctcgcatcaacggcaacatgcaccccagagc
caatcgcacttttcttcgaatccgtcgcattattcttcgaactcatctcattactcttcg
cgttcgtcccgctcctcaccaccaatctcattggagcacctctctcttgagtccaaacaa
gatgagcaccgacctactcgtcgtccctcccgaacccccctaggcgactcgagctctagc
ttagatcagtccctacgaccttctataggctctcgttcagctagctcgcataacaccaac
tcgcgaatgccgctacagagcacggccctgcctttccgtgttgcacctacgcctggtgga
tatcccacccccaactcaacatcctggcagcggcgcggcgaccatatgggggccctctaa

DBGET integrated database retrieval system