KEGG   Aspergillus nidulans: AN3464.2Help
Entry
AN3464.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AN3464.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 242 aa AA seqDB search
MAWYCSGSTNSELIENLCREGLIKNERVKQAMMAVDRGHYAPARPYSDSPQPIGHGATIS
APHMHGHACEYLINYLRPGAHVLDIGSGSGYLTHVFANLVVDTSSSDGPKGQVIGVDHIQ
ELVNLAHDNMMKSEDGRKLLENGGVKFVKADGRRGWLDGAPYDAIHVGAAAQELHPLLIE
QLRAPGRMFIPVNAEDDQGTLFSTAFGGGQYIWVVDKKKDGTIHKEKVFQVSYVPLTDPP
KH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggtactgttccggatcaacaaactcagaactgattgagaacctatgcagagaa
ggactgataaagaacgagagagttaaacaagcaatgatggcagtcgaccgcggtcattat
gcacctgctagaccgtactcagactcgccgcagccgatcggccatggagcgacaatttcc
gctccccatatgcatggacatgcgtgcgagtatcttatcaactaccttcgacctggcgcc
catgtcctagacattggctctggctctggttatctaacccatgtatttgccaaccttgtc
gtggatacgtcatcgagcgatggcccaaaaggacaagtcatcggcgtcgaccacatacaa
gaactcgtaaacctggcacacgacaatatgatgaagtcagaggatggaagaaaactgcta
gaaaatggaggcgtgaagtttgtcaaggccgatggccgccgtggatggctagatggcgcg
ccatatgatgcgatccacgttggcgcagcagcacaagagctacaccctctgctaatcgag
cagctgcgagcgcccggacgtatgttcatacccgtcaatgccgaggacgaccaagggacc
ctgttcagtaccgcattcggcggtgggcagtatatatgggtagtggacaagaagaaagat
ggcactatacacaaagagaaagtgtttcaagttagctacgtccctctcactgacccacca
aagcattga

DBGET integrated database retrieval system