KEGG   Aspergillus nidulans: AN3466.2Help
Entry
AN3466.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ani  Aspergillus nidulans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ani01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ani00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ani00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 453 aa AA seqDB search
MASRLSLRQFSAQRLRTFTTSKGSENARSASGLIQGLQKGPALRNGFSRVNVIPISNYQV
RTYADTVVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIETDKIDVSVNAPESGVIK
ELLVNEEDTVTVGQDLVKLEAGGTPEKKSEEATEKPKEPASTGSEAEKPKEPESAPSSSA
PEKSTSSTKAPQAETSKPTQEVASKSRPTEEAKPALGNREERRVKMNRMRLRIAERLKQS
QNTAASLTTFNEVDMSSLMEFRKLYKDEILKKTGVKLGFMSAFSRACVLAMKDVPAVNAS
IEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKSIADLGKKARDNKL
TIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDKPVAIGGKVEIRPMMYLA
LTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccgattatctctgcgtcaattttccgcccagcgtctaaggactttcacaacg
agcaagggatctgaaaacgccagaagcgcttccgggttgattcagggcttacagaaaggc
ccggctttacgaaacgggttttcgagagtcaacgtcatcccaatttcgaattatcaggtt
cgaacctatgccgatactgtcgtcaaggttccgcagatggcggaatcaattacagagggt
acattgaagcaattctcaaaacaggtcggagactatgtcgagcgggatgaagagattgcg
acaattgaaactgacaagattgatgtatcggttaatgcgccggagtccggagtcatcaag
gagctgctcgtgaacgaggaagatacggttacagtcggacaggatctggtgaagctggaa
gccggtggtactccggaaaagaaatcagaggaagcgactgagaagcccaaggaacctgcc
tctaccggctctgaggctgaaaagccaaaggaaccagaatccgcaccatcttcttctgct
cctgagaagagcacctcatcaacaaaggctcctcaggctgaaacttccaagccgacacag
gaagtggcatccaagtctcgaccaacggaggaggcaaagcccgcactaggaaaccgtgag
gagagaagggtcaaaatgaaccggatgagactaaggatcgcggaacgtttgaagcaatcc
cagaacaccgctgcttccctgactaccttcaatgaggtcgacatgtcttctttgatggag
tttcggaagctgtacaaggatgagattcttaagaaaacaggtgtcaagctggggttcatg
agtgccttctctcgtgcttgtgttctggctatgaaggatgttcccgccgttaacgcttcc
atcgaaggccccaatggtggtgataccattgtttaccgcgattatgtggacatcagcgtc
gctgttgccacggagaaaggcctagtgacacccgtggtccgcaacgctgagactatggat
ctcgttggtattgagaagtctattgcagatcttggcaagaaggcacgtgacaacaaactg
actattgaagatatggctggaggcacctttaccatcagcaatggtggcgtttttggatct
ctcatgggcacgcctattatcaaccttccacaaactgctgttctcggtctgcatgccatt
aaggacaaacccgtggccatcggcggcaaggttgagattcgtccgatgatgtatcttgcc
ctcacttatgaccatcgacttctggatggcagggaggccgtcactttcctagttaaggta
aaggagtatattgaagaccctcgccgcatgcttttgggttag

DBGET integrated database retrieval system