KEGG   Aspergillus nidulans: AN3469.2Help
Entry
AN3469.2          CDS       T01016                                 

Definition
H2B_EMENI Histone H2B
Orthology
K11252  
histone H2B
Organism
ani  Aspergillus nidulans
Brite
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AN3469.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 140 aa AA seqDB search
MPPKAAEKKPSTGGKAPAGKAPAEKKEAGKKTAAAASGEKKKRGKTRKETYSSYIYKVLK
QVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSAK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagctgccgagaagaagcctagcactggcggcaaagcccctgctggcaag
gccccagctgagaagaaggaagctggaaagaagaccgccgctgctgcctctggcgagaag
aagaagcgcggaaagaccaggaaggagacctactcttcttacatctacaaggtcctcaag
caagtgcacccggacactggtatctccacccgtgctatgtctattctgaactctttcgtc
aatgatatctttgagcgcgttgcgacggaggcgtccaagctcgctgcttataacaagaag
tccaccatatcatctcgagaaatccagacctctgtgaggctgattctgcccggagaactc
gccaagcacgctgtgtctgagggcaccaaggccgttacgaagtattcctcatctgccaaa
tag

DBGET integrated database retrieval system