KEGG   Aspergillus nidulans: AN3587.2Help
Entry
AN3587.2          CDS       T01016                                 

Definition
similar to CREB
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ani  Aspergillus nidulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 766 aa AA seqDB search
MGSFLKSFRKDVGSAAPSVGAPPAKKEPQPLPMTPLEKMLTELGPIRGDGSDKFYGMENF
GNTCYCNSILQCLYYSVPFREAVLNYPKRTPIEDLEAALAKALRYQDPNARLEAEALAEK
QKAANSPRPGQPPNPQQKPEDKDSPEYKKKLALQTLPLLETTDNSVSYGIPESLFSSLKD
MFESIVGSQSRIGIIRPQHFLEVLRRENEMFRTAMHQDAHEFLNLLLNEVVVDVEKAAAK
LLESPQPASDVSDSVIPSSSSGSRTPNTTRWVHELFEGLLTSETQCLTCEKASQRDEVFL
DLSVDLEQHSSVTSCLRKFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALHLK
RFKYTEDLQRLQKLFHRVVYPYHLRLFNTTDDAEDPDRLYELYAVVVHIGGGPYHGHYVS
IIKTQDRGWLLFDDEMVEPVDKNYVRNFFGDKPGLACAYVLFYQETTMEAVMKEQEQENT
EPPVEVNASTLKQNGFSSSATLAHAHSASQVPTYEDHDRFTGLKRAPTAPQLSTHPEHTT
TDSESLPSPAPDPAPLTSLPPIPPIPETPPAPLTSRKSDLQSKKERVKEEKERKAAEKEK
EKQRRKEIETRLKDRQRREDDDLKAALEASKVSKEDEDRRNHAENGTSKKNAGGLGRFRS
LSQRLSTKESRTSLSRIPPLPNGNHTLSKVPDESEQTHPKSPTPPAPLSRPASQPLNDDL
LGSPRADTLAVPTEQEHIKNSKHDRSSHGKWRSFSLRKKSFNILSS
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtttctgaaaagtttccgaaaagatgtgggatctgccgcaccttctgttggg
gcaccacccgcaaagaaggagccccaaccacttccgatgaccccgttagagaagatgctt
actgagctgggcccgatccgaggtgatggcagcgacaagttctacggaatggaaaacttc
ggaaacacttgttactgcaactcaattttacaatgtctttactattctgtccccttccga
gaagccgttcttaactatcccaagcggacgccgatcgaggatctagaagcagcgctcgca
aaagccctccggtatcaggatccaaatgcccgtctggaagcggaagctctggcagagaag
cagaaggccgccaactccccacggcccggacagcctccgaacccgcagcagaagccagaa
gataaggattcgccggagtacaagaagaagttggccctgcaaacgctccctctcctcgag
actactgataactcagtcagttatggtataccagagtcattattttcttcactgaaggac
atgttcgagtccatcgtggggagtcagtcacgaattgggataatccggccgcagcatttc
ttggaggtgctccgtcgcgaaaatgagatgttccggacagccatgcatcaggatgctcat
gaatttctcaacctcttgcttaacgaggtagttgtggatgtggagaaagccgccgcaaaa
ctattagagagccctcagcccgcgagtgacgtttcagattccgtcattccttcgtctagt
tcaggttctagaacgccaaacaccacacggtgggttcacgaactgtttgagggtctactt
acttctgagacacaatgtctcacttgcgaaaaagcgtctcaacgagatgaagtcttttta
gatctatcggtggatctggagcagcattcgtcggttacctcatgtttgaggaagttctcg
gcagaggaaatgctttgtgagaggaacaagtttcactgtgacaactgcggcggactacag
gaagcagagaagaggatgaagatcaagcgtctaccccgaattctggctttgcatttgaaa
cgtttcaaatataccgaagacctgcaacgactacagaaactctttcatagagttgtctac
ccctaccaccttcgtctcttcaacacgactgatgatgctgaggatcccgatcgtctttac
gagttatatgcggtggtcgtacacatcggcggtggtccttaccatggacactacgtttcg
atcatcaagacccaggatagaggttggctgcttttcgatgatgaaatggtagagccggtg
gataagaactatgtacgcaacttctttggtgacaaaccagggctagcctgtgcgtatgtg
cttttctaccaggagacaaccatggaggccgtgatgaaggagcaggagcaggagaacacg
gagccgcctgttgaagtaaatgcgtctactctgaagcaaaacgggttttcctcttcggca
acacttgctcacgcccacagcgcatcccaggtcccgacatatgaggaccatgaccgtttc
acgggcttgaaacgagctccaaccgcacctcaactatcaacgcatcctgaacatactacc
acagactcagaaagtctaccctctcccgctcctgatcctgctcctcttacttcattaccc
cctataccgccaatccctgagacaccaccggctccgctaacatcgcgaaagagcgatttg
cagtctaaaaaagaacgggtcaaagaagagaaggagcggaaggcggccgagaaagaaaaa
gagaagcagcgccgaaaagagattgagacaagactcaaagatcgacaacggcgcgaagac
gacgacttgaaggcagctctcgaggcaagcaaagtgtcaaaagaagatgaagatcgacgc
aatcacgccgagaatggtacctctaagaagaatgccggtggtcttggacgattcagaagt
cttagccagcgcttaagcaccaaagaaagccgtacatctctgtcacgaatcccgccgctt
ccgaatggaaatcacactctgagcaaagtcccagatgagtccgagcaaacgcatccgaag
tcaccaacaccgccggcgccgttgtcgcgaccagcatcacagccacttaatgacgatctt
ttaggttctccccgcgctgatacccttgcggttcctacagaacaggaacatattaaaaac
tcaaagcacgaccggtcgagtcatggcaagtggcgaagctttagcctcagaaagaagtcc
tttaatatcctctcatcatga

DBGET integrated database retrieval system