KEGG   Aspergillus nidulans: AN3621.2Help
Entry
AN3621.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AN3621.2
Transcription machinery [BR:ani03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AN3621.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 434 aa AA seqDB search
MGPVSVMVAGEKRIGAVRSKHRVFIVCGVLVIQLASSNLQTTVQGDRKASEEALSPDSQQ
QSKKTRTDSPERELKPPLRIVPFPEKPAVLEERRGEIEFRVVNNDGSRDSFIVLTGLKCI
FQKQLPKMPKDYIARLVYDRSHLSIAIVKHPLEVVGGITYRPFNSRRFAEIVFCAISSDQ
QVKGYGAHLMSHLKDYVKATSDIMHFLTYADNYAIGYFKKQGFTKEIQLDRSIWMGYIKD
YEGGTIMQCTMLPKIRYLESGRMLLKQKEAVHAKIRAFSKSHIIHPPPKEWKNGPVKIDP
LSIPAIKESGWSPDMDELARQPRHGPNYNQLLHLLNDMQNHSAAWPFTQPVNKDEVLDYY
EVIKEPMDLSTMEEKHEKDMYPTPQDFIKDAVLMFDNCRRYNNENTPYAKSANKLEKFMW
QQIRNIPEWSVSTI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggaccggtgtccgtcatggttgcgggtgaaaaaaggataggagcagtacggagtaaa
caccgggtatttattgtatgtggtgttctagtgatacagcttgcgtcttcaaatctccaa
acaaccgtacagggagatcggaaagcctcggaggaggctctttccccagattctcaacaa
cagagcaagaaaactcgcaccgattctccagagcgggaactgaagccgccgctgcgaatc
gttccttttcccgagaagcccgccgtgctagaagaacgccgaggcgaaatcgagtttcgc
gtggtcaataacgatggttcgcgcgatagcttcattgtcctcaccggactgaaatgcatc
tttcaaaaacaacttcctaaaatgccaaaagactatattgcccggttggtctacgatagg
tcgcatctctcgattgccattgtcaagcatccactggaagtcgttggaggtataacctac
cggccgttcaacagccgcaggtttgcggagatagtcttttgcgccatttcttctgatcag
caggttaagggatatggtgcgcatctgatgtcccatctgaaagactacgtcaaggccact
tcggacattatgcactttctgacctatgccgataattatgcgatcgggtatttcaagaaa
caaggattcacaaaagagattcaactggaccgatctatatggatgggctacatcaaagat
tatgaaggaggaaccatcatgcagtgcacaatgctcccgaaaatccggtatctcgaatcc
gggcgcatgttgctcaaacagaaagaggcggtccacgcaaagattcgtgccttcagcaaa
tcgcatatcatccatccgccgccgaaggagtggaagaacggacctgtcaagattgacccg
ttgagcattcccgccattaaagagtccggctggtcgccggatatggacgaactcgctcgt
cagccacgacacgggccgaattacaatcaactcttgcaccttctcaacgatatgcaaaac
cacagcgcagcatggccgttcactcaacctgtcaataaggatgaggtgctcgactactat
gaagtcatcaaggagccaatggatctgtcgacgatggaggagaagcacgagaaagacatg
tacccgacgccacaagatttcattaaagatgccgtattgatgtttgataactgtcggcgg
tataataacgagaacacaccctacgccaagagcgcgaacaagttagagaagttcatgtgg
cagcagattcgaaacatccccgagtggtcggtaagtacaatttga

DBGET integrated database retrieval system