KEGG   Aspergillus nidulans: AN3711.2Help
Entry
AN3711.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AN3711.2
Peptidases [BR:ani01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AN3711.2
Transcription machinery [BR:ani03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AN3711.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 397 aa AA seqDB search
MESRNRALFCQGCEDLVYDHGLERCRSATPESTLKGPLARKRRFSESSADELYVKSNANR
RPCAKQGVRGLFNLGQTCYLNVILQTLLHDPILSTYFLGNGHQPHDCTVADCIGCAVAEA
FADFHSIDKPEGFAALNLLLASWRASPTLAGYQQQDAHEYYQFLVDKLHTSAEGNRENHE
KGCSCFFHRTFYGKLRSSVTCDRCGNVTKTEDPIVDLSLDVQVQAKKRAMGGGTGPSATP
TLSGCLESFTSPEKLMADVYNCSGCGNTPQKATKQLRIKKLPAILCMQLKKQRFEHTFSV
SEKVEGRIDFPLSINMLPYTTNPDSAVDKSRYTYDLSSAVVHKGKLEAGHYYVYCRQGDE
WMLFNDDQVTPVTEAEVLGVDAYLLFYNLRCLANAAS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagaaaccgagctttgttttgccagggctgcgaagatttggtgtacgatcac
ggcctagaacgatgcagatcagcaaccccagagagcacattaaaaggtccgctcgcaagg
aaacggcgttttagcgagagctcggccgacgaactttacgtcaagagcaacgctaaccgg
cggccgtgtgcgaagcaaggcgttagaggcttgttcaatctcgggcagacatgctacctg
aacgtcattctgcagacgctattgcatgatccgatcctcagtacctactttctcggtaat
ggtcaccaaccgcatgattgcacggttgcggattgcattggatgcgctgttgctgaagct
tttgccgatttccacagcatcgacaagccggagggcttcgcggcgctcaacctgcttctg
gcctcctggcgtgcaagcccaaccttggctggttatcaacagcaggatgcgcatgagtac
taccagttcctcgtcgacaagctgcataccagcgcggaggggaaccgggaaaaccatgaa
aaaggctgcagttgtttctttcaccgaacgttttacggcaagcttcgaagcagtgtgacg
tgcgatcgttgtggtaatgtcacaaaaacggaagatccaattgtcgatttgagtctcgac
gtacaggttcaggcgaagaaacgagccatgggcggcggtaccggcccctccgcaacaccc
acactcagcgggtgcttggagagctttacctcgccggagaagcttatggccgatgtatac
aactgcagcggctgtggcaacaccccccagaaggcaacaaagcagctccggatcaagaaa
ctcccggcgattctgtgtatgcagcttaagaagcagcgctttgaacacaccttttccgtc
tcagaaaaagttgaaggccgtattgacttccccttatcaatcaatatgcttccatacact
acgaaccccgactctgccgttgacaaatcacggtacacgtatgacctgtcttcagctgtt
gtacataagggcaaactcgaggcggggcattactacgtctactgtcgccagggtgatgag
tggatgctcttcaacgacgatcaagttacccctgtcactgaggcggaagtcctcggtgtt
gacgcttatcttctattctataatcttcgctgcctggccaatgctgcgtcgtag

DBGET integrated database retrieval system