KEGG   Aspergillus nidulans: AN3719.2Help
Entry
AN3719.2          CDS       T01016                                 

Definition
similar to T51943 mitogen-activated protein kinase [imported] - Aspergillus nidulellus
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ani  Aspergillus nidulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 361 aa AA seqDB search
MVQQMPPQGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSM
FCLRTLREMKLLRYFNHENIISILDIQRPRNYESFNEVYLIQELMETDMHRVIRTQDLSD
DHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGF
MTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFKALFPKSNDLALDLLEKLLAFNPTKRIT
VEEALRHPYLEPYHDPDDEPTAPPIPEGFFDFDKNKDALSKEQLKSKYLAPIDSISYATI
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcagatgccgcctcagggaggctcaaggaagatttcctttaacgtctcagat
caatatgagattcaagacgtcattggtgaaggcgcctatggtgttgtttgctctgctatc
cacaagccctctggccagaaggtagccatcaagaagatcaccccctttgaccattcgatg
ttttgcctgcgaaccctacgagagatgaagctgctccgctacttcaaccatgagaatatc
atctccattttggacatccagaggccgcgaaactatgagagtttcaacgaagtctacctc
attcaggaattgatggaaacagatatgcaccgcgttatccgcacgcaagacctgtcagat
gaccactgccagtactttatttaccaaactttgcgtgcgctgaaggccatgcactccgct
aacgtcctccaccgtgatctcaaaccatcgaaccttctcctcaatgcaaattgtgacctg
aaggtctgcgactttggtctagctcgatctgcggcttcgactgacgataattctggtttc
atgacggaatacgtggcgacgcgctggtaccgtgcacctgaaatcatgttgacgttcaag
gaatacacaaaggcaattgatgtgtggagtgtgggctgcattcttgcagagatgctgagc
gggaagcccttgttccctggaaaggactatcaccatcaattgactctaattctggatgtt
cttggaacacctaccatggaagactactacggaatcaagtcccgacgggctcgggagtac
atccgttctctcccattcaagaagaagattccgttcaaggcactgttccctaagagcaac
gacctagctctggatctgctagagaagcttttggccttcaacccgacgaagcgaatcacc
gtggaggaggctctgcgtcacccgtacctggaaccatatcatgatccagatgacgagcca
acagcgcccccaatcccggaaggcttctttgacttcgacaagaataaggatgctctcagc
aaagagcagttgaaaagtaagtatctggcgccaatcgactccataagttatgcgacaatc
aactaa

DBGET integrated database retrieval system