KEGG   Aspergillus nidulans: AN3806.2Help
Entry
AN3806.2          CDS       T01016                                 

Definition
similar to AF164342_1 histone deacetylase HosA
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AN3806.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 482 aa AA seqDB search
MPRSAIVQEYNPTPTLSVDRKSAQHQHEGIIARPSGYRVSWHANPAVELHHFGQSHPMKP
WRLTLTKQLVLAYGMHHAMDLYHCRAATVEELSDFHTSDYLDFLQTVVPGDMNDAQASKD
FSENIVRFNFGDDCPIFDGLFQYCSLYAGASLDAARKLCNNQADIAINWSGGLHHAKKAE
ASGFCYVNDIVLAILQLLRIHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKENF
FPGTGPLDSTGPTHPLNPGAHHAVNVPLHDGIDDESYVQLFKDVVGACVSKFRPAAIVLQ
CGADSLGCDRLGCFNLNVAAHGACVAYTKTFGLPMLVVGGGGYTPRNVSRAWAHETSILI
DAQDKINPVIPSNVAFRNHFGPDFSLFPPLSEMRKLENKNSRAYLATIVQTITEQLRYLQ
AAPSVQMSVIPPDLLGLREETEKEIEEEIAKLEEKREEAEGGKNSRRRDAEKGAGLRGEL
YS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccccgttccgccattgtacaagagtacaaccccactcccacgctctcggtcgaccgc
aaatccgcccagcatcaacatgaaggcatcatcgcgcggccatcgggctaccgggtatca
tggcacgcaaaccctgcggtagaactgcatcacttcggccagtcgcacccaatgaagcca
tggcgcctcacactcaccaaacaacttgtgctcgcctacggcatgcatcatgcgatggac
ctataccactgtcgtgccgcaactgttgaagagctcagcgacttccacacatccgattac
ctggactttttgcagacagtggtgccaggtgacatgaatgacgcgcaagcgtccaaggat
ttcagcgaaaacatcgtccgcttcaattttggcgacgattgccccatcttcgacggccta
ttccaatactgctcgctgtacgcgggagcctcgctcgacgccgcccgcaagctctgcaac
aatcaggcagatatcgcaatcaactggtctggcgggctgcatcacgccaaaaaggccgag
gccagcggcttctgctacgtaaatgatattgtgcttgcgatcctgcagctcctccgcata
cacccgcgcgttatgtacatcgatattgacgtccatcacggcgacggtgttgagcaagcc
ttctggtctaccgaccgcgtcctcacagtttcgtttcataaatatgacaaggagaacttt
ttcccgggcacagggcccttagatagtacagggccaacacacccgctcaacccaggcgct
catcacgcagtcaatgtacccctccacgacggcatcgacgacgaatcttatgtccagctc
ttcaaggacgttgtaggtgcctgtgtcagcaagttccgaccggccgctattgtcctccag
tgcggcgccgactcgttgggctgcgacagacttggctgcttcaacttgaatgtggccgca
cacggcgcctgcgtcgcgtacacaaagacattcggactacctatgctcgtcgtcggcggc
ggcggctacaccccgcgcaacgtctcacgagcctgggcgcacgaaacctccatactaatc
gacgcccaagacaaaatcaaccccgttattccgtccaatgttgcatttcggaaccatttc
ggcccggacttctcgctgtttccgccgctgtcggagatgcgcaagctcgaaaacaagaac
tcgcgcgcttacttggcgacaattgtgcagacgatcacggagcagctgaggtatttgcag
gcggcgccgagcgtgcagatgtctgtgattccgccggatctattagggctcagggaggaa
acggagaaagaaatcgaggaggagattgcgaagttggaagagaaaagggaggaggccgaa
ggtgggaagaattctcggaggagagatgcggagaagggtgctggactgcggggagagttg
tattcttga

DBGET integrated database retrieval system