KEGG   Aspergillus nidulans: AN3916.2Help
Entry
AN3916.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ani  Aspergillus nidulans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ani00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 608 aa AA seqDB search
MDPAKIFVGSIDQGTTSTRFLIFNREGDPVASHQVEFKQIYPNPGWHEHDPLELVSSVET
CIEEAVKQFEINGYDQQSIKAVGITNQRETTVVWDHETGEPLYNAIVWTDTRSQAVVDEL
KKKPGASQLQQICGLPLSTYSSSSKLLWMLTNVPKVKEAYEKGTLAFGTVDAWLVYRLNG
GSAANVFVSDCTNASRTMFMNLETLGYDDFLLDFFGIKGRVHLPKIVPSSDVTAYGALSN
GRLAGVPIMGCLGDQSSALVGQKGFSPGMAKNTYGTGCFLLYNVGDKPVISKHGLLATIA
YNFDGRPVYALEGSIAVGGSGIKFLQNNLEFFRESKEVNDLALTVEDNGGCVFVTAFSGL
YAPYWIDDAKGTIFGITQYTQKGHIARATLEATCFQTKAILNAMEKDSGHALFELAVDGG
MSNSDLAMQIQADLISIPVYRPKMRETTALGAAIAAGLAVGLWRNFAELRDINRAGGTVF
RPQTSQDISREQFSLWEKAVSMCRGWVGDKSHATEHRDTEGKPTQKVDLSNGHKGVVDAA
SATAPSNIVSPLLSAKMNGDLVLSKGTPWINISGDLEDADDQDLFLELRKLEILQRLKRL
GKVKVTYF
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggacccagcaaagatttttgttggttctatcgatcagggaaccaccagcacccgattt
ctaatctttaatcgcgagggagatcctgtcgcatcacatcaagtcgaattcaagcagata
tatcctaacccgggatggcacgagcacgatccgctagagcttgtatcttctgtggaaacc
tgcatcgaagaagctgttaaacaattcgaaatcaacgggtacgaccaacaatctattaag
gcggtgggaattaccaatcagcgagagactacagttgtttgggaccatgaaaccggggag
ccactttataatgcgattgtctggaccgacacccgctcgcaagctgttgttgatgagctt
aaaaagaaacccggagcatcgcaacttcaacagatctgcggtctgccgctctcaacctat
tcctcttcctctaagctcctctggatgcttacaaatgttcccaaggtcaaagaggcatac
gaaaaaggcaccttggccttcggaactgttgatgcctggttggtttaccgactgaacggc
ggaagcgctgccaatgttttcgtctctgattgtacgaacgcctcacgtacaatgttcatg
aacctagagacactgggatacgacgacttcttgctggatttctttggcattaagggccga
gtacacctgcccaaaattgttccttcttcagatgtcacagcctacggtgcactctccaac
ggcaggcttgcgggggttcctatcatgggatgcttgggagatcagtcctcagcccttgta
gggcaaaaagggttctcccccggcatggccaagaatacatatggcacaggatgcttcctg
ctgtacaacgtcggggacaaaccagttatctccaagcacggccttctggcgactatagcg
tataatttcgatggacgaccagtatatgcgctcgaaggaagcatagcggttggtggatct
ggaatcaaattccttcagaataatttagagttcttcagggagtctaaggaagttaacgac
ttggctttaactgtggaagacaacggcgggtgtgttttcgttaccgcgtttagcggactt
tacgctccgtattggatcgatgatgcaaagggaactatatttgggatcacccaatatacc
cagaagggccacattgcccgagcaacactggaagcgacctgcttccaaaccaaggcaatt
ctgaatgccatggagaaagacagcggacacgccctattcgagctcgctgttgatggagga
atgagcaactcggatctcgctatgcagatccaagccgacctcatctccatccccgtttac
cgccccaagatgcgcgaaacaaccgccctcggcgccgccattgccgcaggcctagctgtc
ggtctctggcgcaacttcgccgagctccgcgacatcaaccgtgccgggggtacagtcttc
cgcccgcagacgagtcaggacataagccgcgagcaattttccctctgggaaaaggcagtg
agcatgtgtagagggtgggttggcgataaatcgcacgcaacggagcacagagacactgag
gggaagcctactcagaaggtggatctgagtaacggtcataagggggttgttgacgcggct
tctgccactgcccctagcaacattgtgtcaccattgttgtcggcgaaaatgaatggggat
ttggtgctatcaaagggcacgccgtggattaatatctcgggggatttggaggatgctgat
gatcaggacttgtttctggagttgaggaagttagagattttacagaggctgaagaggttg
ggtaaggttaaggttacctacttttga

DBGET integrated database retrieval system