KEGG   Aspergillus nidulans: AN3920.2Help
Entry
AN3920.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ani  Aspergillus nidulans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AN3920.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AN3920.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 602 aa AA seqDB search
MRGSCAASSALKRLERPLAFPCNGQRRFLHAISEGHTVGIIGGGITGLTAAYRLSRDPKC
SKVTVYEKGPRVGGWIQSEKINVDGEHIVFEYGPRTLRASTITAFPLLDLLTELGLEDEM
LITKTSSAASQNRYIYYPDRLVRMPGPQKGASRISQLITTLKSLLQEPVFESVLPSLLKE
PFVKRPLNLPSDESVMEFVSRRWSTKIADNLASSVFQGIYAGNIDKLSAETLLGPLRAHE
LSGSVAKGITEMKGKQYWISDDFISMLLISEAKKASHLDYLRSLAKDSSTLTFKNGVGQL
ADALVAELKRSPKVEVLTHANVTSILQDHESSNLTVKVEDGQSRVHNRLIATNPPCDLAR
QLQCSLEPEKQPTGTINALQRHNYATTTMVVNLYYSNPDLIPVRGFGYLIPRSIPFAQNP
ERALGVIFASESSVGQDTATGTKLTVMMGGHYWDGWKESDYPDHDTAVSMSQALLKRHLG
ILDSPKVAHTRLQRDAIPQPTVGHLERMQDISTSIKSELKNRVTLAGAWYSMHGTGVVDS
IRQAYLAAKYGPELEYSGAPFPFPSLTDSLGGGGIITHYQPRWITASSEELFRKCGIEKN
PN
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggatcatgcgccgctagttctgcactaaagcgtttagaaagaccattggctttt
ccttgcaatggtcaacggcgcttcttgcatgccatttcggagggacacactgttggcatc
ataggcggtggaatcactggcctcacagccgcataccgattatccagggacccaaaatgc
tccaaggttaccgtctatgagaaaggccctcgcgtgggcggctggattcaatccgagaaa
attaacgtggacggagagcatattgtcttcgaatatggaccgcgtacactgcgagctagc
accattactgcatttccacttttggacttgttgaccgagctggggctagaagacgaaatg
cttatcacgaaaacgtcatccgccgcgagccagaaccgctatatctattaccccgatcgc
ctcgttcgtatgccggggccgcagaaaggggccagtcgaatatctcagctcataacgacg
ttgaaaagtctactacaagaaccagtcttcgagagtgtgcttcctagccttttgaaggag
cccttcgttaagcgtccattgaacttgccttcagacgaatccgtcatggagtttgtatca
cgacggtggtctaccaaaatagctgacaatttggcttccagtgtatttcaaggcatatat
gcagggaatattgacaagctgagtgcggaaacgctcctgggcccgcttcgggcgcatgag
ttgtctggtagtgtagccaagggtataacggagatgaaagggaaacagtactggatttcg
gacgatttcatttccatgctcctcataagtgaagcaaagaaagcgtctcacttagactac
ctcagaagcctggcaaaggacagcagtacattgactttcaagaacggcgtcggtcagctg
gcagacgctctggttgcagagttgaaacgatcaccaaaagttgaagtcctcacgcatgca
aatgtcacaagcattctccaagatcatgagagctccaacctcactgtaaaagtagaagat
ggtcagagtcgtgttcacaaccgtctcattgctaccaacccgccttgcgacctcgcaaga
caacttcagtgttcactggagcccgagaagcagcccacaggaacaataaatgccctacag
agacacaactacgcaacaactactatggttgtgaatttgtattactcaaatcctgatctg
atccctgttcgaggtttcggctacctgattcccaggtcgataccttttgcgcagaatcct
gagcgagcactgggtgtgatatttgcttcagaatctagtgtaggtcaagacacagccacc
ggcacaaagctcacagtcatgatggggggccattattgggacgggtggaaagaatcagac
tatccggaccacgatactgcggtctcgatgtctcaagccttactgaaaaggcatctgggc
atcctggattctcccaaagtagcccacacccgattgcagcgcgatgctattcctcagccc
accgttgggcatcttgaacgtatgcaagacatttcaacgtctattaagtctgagctcaaa
aaccgtgtcactctggctggggcgtggtattcaatgcatggtaccggcgtggtggacagc
attcgtcaggcttatctagctgcgaaatatggccctgagctggaatactcaggagcaccg
ttcccttttccatccctgacggattcacttggtggtggtggtataattacccactaccaa
cctcgctggataacggcgtcatctgaggaattgttcaggaaatgtgggatagaaaagaat
cccaattag

DBGET integrated database retrieval system