KEGG   Aspergillus nidulans: AN4071.2Help
Entry
AN4071.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AN4071.2
    1.3.1.94  polyprenol reductase
     AN4071.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 317 aa AA seqDB search
MDAVDALRAFFIFAACTIFSVSLPDSLRSRFIPYGARATKAAAESETSATSTSASKSTSA
APASVSAVTRALDYAAALRVPHSYFTQFYVILVLSSIFWALQLLSHGRAFQAIAARIRPE
HLDQAISINQVMLCWGLLLTQGLRRLHECLSFSKPSSSTMWFVHWFAGLGFYLAVAVAVW
IEGAGTVLTHQLSLDDFDLTSRFSGRTLLSLPIFLIASGIQHDCHHYLSSLKKYTLPTHP
MFNWILCPHYTAECIIYLSLAYLAAPKGEIMNKTLLSAVFFVAVNLGITASTTRQWYRQK
FGESAVQGKWNMIPLIY
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtcgatgcactccgagccttcttcatcttcgcagcttgtacgatcttctct
gttagtctgccagattcacttcggtcgcggtttatcccctatggtgctcgtgcgacaaaa
gctgcagccgagtcagagacgtccgcaacctcgacctcggcctcgaaatcgacctcagcc
gcgcccgcgagcgtgtccgcggtaacacgcgcccttgattacgccgctgcgctgcgagtc
cctcacagctacttcacccagttttacgtcatcttggttctatcgtcaattttctgggct
ctgcagctgctgtctcacgggcgcgcgttccaggccatcgcagctcgaatccggccagaa
cacttggaccaagcaatctcaataaaccaggtcatgctgtgttggggcttgctgttgacc
caagggctgagacggctacatgagtgtcttagcttctccaagccatcgtcatccacaatg
tggttcgttcattggttcgcaggtctcgggttctacctggctgtagccgttgcggtctgg
atcgagggagcagggacggttctcactcatcaattgagtctcgacgactttgatctgacg
agccgcttctctggacgcacgcttttgagtcttcccattttcctcattgcatcgggtatc
caacacgactgccaccattatttgtcttctctgaaaaaatacactctgcctactcacccc
atgtttaattggatcttgtgtccgcattacacggctgagtgcataatctacctatcccta
gcctatttggccgcgccgaagggcgagatcatgaacaagacattactgtctgcagtcttt
ttcgtcgcagtcaatttaggcataacagcatcaacaacccggcaatggtacaggcaaaag
tttggcgagtccgctgtccagggaaagtggaatatgatcccgttgatatactag

DBGET integrated database retrieval system