KEGG   Aspergillus nidulans: AN4135.2Help
Entry
AN4135.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ani  Aspergillus nidulans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ani01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ani01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 449 aa AA seqDB search
MAGSKVVEKGSVDGAPAAKLHITELPMTWSNWYQHVNWLNCFFVLFIPLVGCIGAIWTPL
RLHTAIFAIIYYFNAGLGITAGYHRLWAHCCYKATLPLQIYLALAGAGAGQGSIRWWSRG
HRAHHRYTDTEKDPYSVRKGFWYSHIGWIIMKQNYKKVGRSDASDLDADPVVIWQHKNYI
NTALFMTLIFPTLVCGLGWGDWRGGFIYGGILRVFFIQQATNCVNSLAHWIGEQPFDDRN
SPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWWQYDPTKWMIWIWKQVGLAYDLKQFR
ANEIEKGRLQQMQKKVDARRAALDWGVPLKELPVFSWDEFIAESANRALVAIGGVIHDVS
DFIKEHPGGKTFISSAVGKDATAMFNGGVYQHSNAAHNLLAMKRVGVVRGGGEVEIWKDA
KQPSKVSFPEMVRAGEQITRRTVPVLDRS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctcgaaagtggtggagaaaggttcagtcgacggcgctccggccgcaaaacta
cacattactgagctacctatgacatggtcaaactggtatcagcacgtcaactggctaaat
tgcttctttgttctcttcattcctcttgtcggatgtataggggctatctggactccattg
cggttgcatacagccatatttgcaattatttattacttcaatgccgggctcggtatcacg
gcggggtaccaccgcctctgggcccattgttgctacaaagccaccctcccactacagatc
tacctcgcccttgctggtgcgggagctggtcaaggctcaatccgatggtggtcccgcggc
caccgagcacaccaccgctatacagacaccgaaaaggacccgtactctgtccggaaaggg
ttctggtactcgcacatcggctggattatcatgaagcagaactataagaaggtcgggcgg
tcggacgcgtcagacctcgacgctgatccggtggtgatctggcagcataagaactatatc
aacactgcactgttcatgactctcatcttcccgacattggtctgtggacttggatggggc
gattggcgcggcgggtttatctacggggggattttgcgagtgttctttatccagcaggcg
acaaattgcgtgaactcgctggcgcactggataggcgagcagccgttcgatgatcgcaat
tcgccgcgggaccatgtcatcacggcactggtaactctgggcgaagggtatcataatttc
caccacgagttcccgtctgactaccggaatgccattgaatggtggcagtatgacccgacg
aaatggatgatctggatctggaaacaggtcgggctggcatacgacttgaagcagttcagg
gcgaatgaaatcgagaagggaaggctgcagcagatgcagaagaaggtggacgctcgacgg
gcggcgctggattggggagttccactgaaggagctccctgtctttagctgggacgagttc
attgctgagtccgcgaaccgagccctggttgcaattgggggtgttattcatgatgtctcg
gatttcataaaggagcacccgggtggaaagacattcatttcgtccgcggtcggtaaggat
gcaacagccatgttcaacggcggtgtttatcaacattcaaatgctgcgcataacttgctc
gcaatgaagcgggttggcgtggttcgtggcggaggtgaggttgagatctggaaggacgca
aagcagccttcgaaagtgagctttccagaaatggttcgtgctggagagcaaataacaaga
aggactgtgccggtgcttgatagatcgtag

DBGET integrated database retrieval system