KEGG   Aspergillus nidulans: AN4135.2Help
Entry
AN4135.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ani  Aspergillus nidulans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AN4135.2
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AN4135.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AN4135.2
Lipid biosynthesis proteins [BR:ani01004]
 Desaturase
  First
   AN4135.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 449 aa AA seqDB search
MAGSKVVEKGSVDGAPAAKLHITELPMTWSNWYQHVNWLNCFFVLFIPLVGCIGAIWTPL
RLHTAIFAIIYYFNAGLGITAGYHRLWAHCCYKATLPLQIYLALAGAGAGQGSIRWWSRG
HRAHHRYTDTEKDPYSVRKGFWYSHIGWIIMKQNYKKVGRSDASDLDADPVVIWQHKNYI
NTALFMTLIFPTLVCGLGWGDWRGGFIYGGILRVFFIQQATNCVNSLAHWIGEQPFDDRN
SPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWWQYDPTKWMIWIWKQVGLAYDLKQFR
ANEIEKGRLQQMQKKVDARRAALDWGVPLKELPVFSWDEFIAESANRALVAIGGVIHDVS
DFIKEHPGGKTFISSAVGKDATAMFNGGVYQHSNAAHNLLAMKRVGVVRGGGEVEIWKDA
KQPSKVSFPEMVRAGEQITRRTVPVLDRS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctcgaaagtggtggagaaaggttcagtcgacggcgctccggccgcaaaacta
cacattactgagctacctatgacatggtcaaactggtatcagcacgtcaactggctaaat
tgcttctttgttctcttcattcctcttgtcggatgtataggggctatctggactccattg
cggttgcatacagccatatttgcaattatttattacttcaatgccgggctcggtatcacg
gcggggtaccaccgcctctgggcccattgttgctacaaagccaccctcccactacagatc
tacctcgcccttgctggtgcgggagctggtcaaggctcaatccgatggtggtcccgcggc
caccgagcacaccaccgctatacagacaccgaaaaggacccgtactctgtccggaaaggg
ttctggtactcgcacatcggctggattatcatgaagcagaactataagaaggtcgggcgg
tcggacgcgtcagacctcgacgctgatccggtggtgatctggcagcataagaactatatc
aacactgcactgttcatgactctcatcttcccgacattggtctgtggacttggatggggc
gattggcgcggcgggtttatctacggggggattttgcgagtgttctttatccagcaggcg
acaaattgcgtgaactcgctggcgcactggataggcgagcagccgttcgatgatcgcaat
tcgccgcgggaccatgtcatcacggcactggtaactctgggcgaagggtatcataatttc
caccacgagttcccgtctgactaccggaatgccattgaatggtggcagtatgacccgacg
aaatggatgatctggatctggaaacaggtcgggctggcatacgacttgaagcagttcagg
gcgaatgaaatcgagaagggaaggctgcagcagatgcagaagaaggtggacgctcgacgg
gcggcgctggattggggagttccactgaaggagctccctgtctttagctgggacgagttc
attgctgagtccgcgaaccgagccctggttgcaattgggggtgttattcatgatgtctcg
gatttcataaaggagcacccgggtggaaagacattcatttcgtccgcggtcggtaaggat
gcaacagccatgttcaacggcggtgtttatcaacattcaaatgctgcgcataacttgctc
gcaatgaagcgggttggcgtggttcgtggcggaggtgaggttgagatctggaaggacgca
aagcagccttcgaaagtgagctttccagaaatggttcgtgctggagagcaaataacaaga
aggactgtgccggtgcttgatagatcgtag

DBGET integrated database retrieval system