KEGG   Aspergillus nidulans: AN4332.2Help
Entry
AN4332.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ani  Aspergillus nidulans
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AN4332.2
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     AN4332.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 429 aa AA seqDB search
MAKDTTLPAQSVTELNACVTTSSHRPVKDTTFREWVVSNQIGISLTTLSMLLAVHHLYPS
LSPYTTPFFQLSYYQPSQGVYIQGWDDIYFVISSVFAFTAIRAIAMEWVFWPLARWSGLK
RKASIRLAEQGWMWLYYAVFWTVGMYIWSQSDYWMDFKAIWAHWPARGVSGLMKWYLLAQ
LAFWVQQIFVINIEERRKDHYQMLTHHFITSCLLTSAYVYGFYNVSNVVLNLMDIVDLLL
PTAKILKYLKFEMSCNIAFGVFMVVWAISRHIMYPLLCWSIFKDVPAVMPWGCYSGATGE
LISTNGYPDRVMHLFSPFLNIDGPICMNRTIKWIFLSSLLALQVLSIIWFSMVIRVAIGV
LRTGNAEDTRSDSEEKDEEEVDPKSAANGNAIAAEVSSAEWRRNGPSSTRSRRSDRKALL
GRIGCDTRT
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggatacgactctgccagcgcagtcagttacggagctcaatgcctgcgtgacg
acctcctcgcaccgtcctgtcaaggacaccacgttccgggagtgggtggtttcgaatcag
atcggcatatccttgacaaccctttccatgctattggccgtccaccacctatacccttct
ctctcgccctacaccacgccgttcttccagctgtcgtactatcaaccttcgcagggggta
tacatccagggctgggatgatatctacttcgttataagctccgtctttgcgttcaccgcg
attcgtgccatcgcgatggagtgggtgttttggccattggcgcgatggtctggattgaag
agaaaagcatcgattcgactcgcggagcagggctggatgtggctatactacgccgtcttc
tggaccgttggaatgtacatttggtcgcaatcggactactggatggactttaaggctatc
tgggctcattggcccgcgcgtggtgtctcgggtctgatgaagtggtacctccttgcgcag
cttgcgttctgggtccagcagatcttcgttattaacattgaggagcggagaaaggatcac
taccagatgttgacccatcatttcatcaccagctgtcttctcacctctgcctatgtttac
ggcttctataacgtctctaatgtggtgctcaacctgatggacatcgtggatttattgctg
ccgactgcaaaaatcctcaagtacttgaaatttgaaatgtcctgcaacatcgcttttgga
gtgtttatggtggtctgggccatttcacgccatatcatgtacccattgctctgctggtcc
atcttcaaggatgtacccgctgttatgccttggggctgctactccggtgccacaggcgag
ctgatctcaaccaacggttatcctgacagagtgatgcacctcttctccccgttcttgaac
atcgacggccccatttgcatgaaccgcacgatcaaatggattttcctctcgtctctgctg
gcgctccaggttctgtccattatctggttcagcatggtcattcgagtggccataggcgtc
ctccgaaccggcaatgcagaagatactcgcagtgacagtgaagagaaggacgaagaagaa
gtagatcccaaaagcgccgctaatggcaatgccatcgcagcggaggtctcaagcgctgaa
tggcgtcgaaacggaccatcctccactcggtctcgccgaagcgatcgcaaggcactcctc
ggacgaatcggatgcgacacccgcacctaa

DBGET integrated database retrieval system