KEGG   Aspergillus nidulans: AN4463.2Help
Entry
AN4463.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ani  Aspergillus nidulans
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AN4463.2
Exosome [BR:ani04147]
 Exosomal proteins
  Proteins found in most exosomes
   AN4463.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 1676 aa AA seqDB search
MAPLPIKFTELINLTNAEIAPASIGFNTCTLESDHFVCVRQKLDDEDKPQVIILNLKNNN
EIIKRPINADSAIMHWSKNIIALRAQGRTIQIFDLSAKQKLKSAVMNDDVVYWKWFSERS
LGLVTESSVYHWDVFDPTQAQPLKVFDRLPNLSNCQIINYRVNDEEKWMVVVGISSQQGR
VVGSMQLYSKERGISQFIEGHAASFASIRVEGSPLEHKLFTFAVRTQTGAKLQIAEIDHQ
EPNPRFQKKAVEVYFPQEAVNDFPVAMQVSRKYDIVYLVTKYGFIHLYDLETGTCIFMNR
ISSETIFTTAPDSESAGLVGVNRKGQVLSVSVDENNIIQYLMENPAMSGLAVKLASKAGL
PGADHLYQQQFDNLLAQGNYSEAAKIAANSPRGFLRTPETINKFKNAPQTGQMSVILQYF
GMLLDKGTLNKYESLELVRPVLQQNRKHLLEKWMRENKLESSEELGDIVRPYDMNLALSI
YLQANVPNKVIAGFAETGQFDKILAYSKQVGYQPDYTQLLQHIVRVNPEKGAEFATQLAN
EESGALIDLDRVVDVFLSQNMVQQATSFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVAD
AILGNEIFTHYDRPRVSQLCENAGLIQRALENTDDPAVIKRNIVRTDQLSTEWLMNFIGR
LSVEQTLDCMDTMLEVNIRNNLQAVVQICTKFSDLLGPSRLISLLEKYRTAEGLYYYLGS
IVNLSEDPEVHFKYIEAATAMNQISEVERICRESNYYNPEKVKNFLKEARLTEQLPLITV
CDRFNFVHDLVLYLYQNQQYKSIEVYVQRVNPSRTPAVVGGLLDVDCDESIIKNLLTTVD
PSVIPIDELVSEVETRNRLKLLLPFLEATLATGNQQQAVYNALAKIYIDSNNNPEKFLKE
NDLYDTLVVGKYCEKRDPNLAYIAYRKGQNDLELINITNENAMYRAQARYLVERADPEIW
SFVLSENNMHRRSLIDQVVATAVPESTEPDKVSVAVKAFLEADLPGDLIELLEKIILEPS
PFSDNGSLQNLLMLTAAKADKGRLMDYIHQLNEFSPDEIAEMCISVGLYEEAFEIYKKVN
NYISAVNVLVENIVSIDRAQEFAERVELPDVWSKVAKAQLDGLRVSDSIESYIHANDPSN
YNEVIETATHAGKDEDLVKYLKMARKTLREPAIDTALAFCYARLDQLAELEDFLRSTNVA
DIEASGDKAYEEGYHQAAKIFYTSISNWAKLATTLVHLEDYQAAVECARKANSVKVWKQV
NQACVDKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIAVLEAGLGLERAHMGM
FTELGIALSKYHPDRVMEHLKLFWSRINIPKMIRACEEANLWPELVFLYCHYDEWDNAAL
AMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTPRIDVNRVV
RIFQASDNIPLIKPFLLNVQSQNKRAVNDAINDLLIEEEDYKLLRDSVDNHDNFDAVELA
QRLEKHDLIFFRQIAANIYRNNKRWAKSIELSKQDKLYKDAIETAAISAKPDVVEELLRY
FVDIGSRECYVGMLYACYDLIRPDVILELSWRHGLQDFTMPFMINFLCEQTRTIEMLKKD
NEERKAREVTQKKDEDNTPILGGSRLMLTQGPAAPAPPVYGQANGITPQATGFRPF
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcttcccatcaaattcacggagctcattaatttgacgaatgctgaaatcgcg
ccggcgtcgattggtttcaatacgtgtactctagaatcggatcacttcgtctgcgtccgc
caaaaactcgatgacgaggataagccccaggttatcatccttaatctaaagaacaacaat
gagattatcaagcgacctatcaacgcggacagtgcgattatgcactggtccaagaacatc
attgctctcagggcgcagggccggacaatccaaatcttcgacctctcagctaagcagaag
ctgaaatccgcggtcatgaatgatgacgttgtctactggaagtggttcagtgaaaggagt
ctgggattggtgacggaatcctcagtctaccactgggatgttttcgatcccacccaggct
cagccattgaaggtctttgatagacttccgaaccttagcaactgccaaatcatcaactat
cgagtaaacgacgaggaaaagtggatggttgttgtcggaatcagcagtcagcagggtcgt
gtcgttggttcaatgcagctatactccaaggagcgtgggatctcgcagttcatcgaagga
catgcagcctctttcgcttctattcgagttgagggctcgcccctggaacataagctcttc
actttcgcggtgcggactcagaccggtgccaagctgcagatcgccgaaatcgaccatcag
gagcctaaccccaggtttcaaaagaaagcagtggaggtgtatttcccccaagaggcagtc
aacgacttcccagttgcgatgcaggtgtctcgaaagtacgacattgtttacctggtcacc
aagtacggtttcattcacctctacgatctagagacgggaacctgcattttcatgaaccgg
atatctagtgagacaatattcacgaccgctcccgactccgaatctgccggtctcgttggc
gtcaaccgcaagggtcaagtattgtctgttagtgtcgacgaaaacaacattattcaatac
ttgatggaaaatccagccatgtccggtctcgctgtcaagctggcttctaaggcaggcctt
ccgggtgccgatcacctctaccaacagcagttcgacaacctgcttgctcaaggtaactac
tctgaagcagccaagattgctgcaaattcccctaggggattcctgaggacgccagagaca
atcaacaagttcaaaaatgccccacaaactgggcaaatgtctgttatcctccaatacttc
ggtatgctactggataaggggacacttaacaagtatgagagtctcgagcttgttcgccct
gtcctccagcagaaccgaaagcacttgctggagaagtggatgcgtgaaaacaagttggag
agctcagaggaactgggtgatattgtccgaccttatgacatgaacctagccttgagcatt
tacctccaagcgaatgtccctaacaaggtcattgcgggttttgctgaaactggtcaattc
gacaagatccttgcatattccaagcaagtcggatatcaaccagattacacacagctcctc
caacacatcgttcgtgtgaatccggaaaagggtgctgagtttgcgactcagcttgccaac
gaagagtctggcgcactcatcgaccttgaccgcgttgtggatgttttcctttcccagaac
atggttcagcaggccacttctttcctcttggatgctcttaaggataacaaacctgaacat
ggccaccttcagacacgcctcctcgagatgaatcttgtcaacgctccgcaggtcgctgac
gccatcctcgggaatgagatttttacacattacgaccgtccccgtgtttcccaactctgc
gagaatgctggtcttatccaaagagccttggaaaatactgacgaccctgccgtcatcaag
cgcaacattgttcgcacggatcaactcagcaccgagtggctgatgaacttcattggccgt
ctttctgttgagcagaccctcgactgcatggacacaatgttggaagtcaacatccgcaat
aacctgcaagctgtcgttcagatctgcacaaagttctccgaccttcttggacctagtcgt
ttaatcagtcttctagagaaatatcgcaccgccgaaggtctctactattaccttggaagt
attgtgaatctttctgaggatcccgaggtacattttaagtacattgaagctgcgactgcg
atgaaccagatctctgaggttgagagaatctgccgtgaaagcaactactacaaccctgag
aaggtgaaaaatttcctcaaggaagctcgtttgaccgaacagttgccgctcatcactgta
tgtgaccgattcaactttgtgcacgacttggtcttgtacctctaccagaaccaacagtac
aagtcgatcgaggtctacgtgcagcgtgtcaacccctcacgcactcctgcggttgttggc
gggttgctcgatgttgattgcgatgagagcatcatcaagaaccttttgaccaccgtcgac
ccatctgtgattcccattgatgagctcgtttccgaggtcgagacccgcaacaggctcaag
ctcctcctacccttccttgaggccacacttgccactggtaatcagcagcaggcggtatac
aacgctctcgccaagatttacatcgacagcaacaacaatccagagaagttccttaaggaa
aacgatctgtatgacactttggttgttggaaagtactgcgagaagcgtgatcccaatctt
gcgtacattgcttaccgcaagggacagaatgacttggagcttatcaacatcacgaacgag
aacgctatgtacagggcgcaggctcgttaccttgttgagagggcggatcccgaaatatgg
tctttcgtgttgagtgagaacaacatgcatcgccgttctctcattgaccaggttgttgcc
actgctgttccagagtccactgaacccgacaaggtctctgttgccgttaaggctttcctt
gaggccgatcttccaggtgacttgattgagcttctcgagaagataatccttgagccgtcg
ccttttagcgacaacggtagcttgcaaaacctgttgatgcttactgctgccaaggctgat
aagggtcgcctcatggattatatccaccagctcaacgaattcagcccagatgagattgcc
gagatgtgtatctctgtcgggttgtatgaagaggcgttcgaaatctacaagaaggtcaac
aactacatttcagctgtcaatgttcttgttgagaacattgtcagcattgaccgggcacaa
gagttcgccgagcgtgttgagctgccggatgtttggagcaaggttgccaaggctcagttg
gacggccttcgtgtctctgattccatcgagtcttacatccatgccaatgacccatccaat
tataatgaggttatcgagaccgcgactcatgccggcaaggacgaggatctcgtcaagtat
ctgaagatggcccgcaagacacttcgggagccagccattgatactgcccttgccttctgc
tatgctcgcctggaccagctcgcagaacttgaagatttcctgcggtcaaccaacgttgct
gacattgaagcttccggtgacaaagcttatgaggagggctaccaccaggctgccaagatc
ttctacaccagcatctctaactgggctaaattggccaccactttggtacatctggaagac
taccaagcggccgttgagtgtgcccgtaaggccaacagcgtcaaggtttggaagcaggtc
aaccaggcatgcgttgacaagaaggagttccgccttgcccagatctgtggtctcaatctc
attgtgcacgcggaggagttgcaagaccttgttcgacagtatgagcgcaacgggtacttt
gatgagctgattgctgtgcttgaagctggtctgggactggagcgggcacacatgggaatg
ttcaccgaactgggtattgctctatccaaataccaccctgatcgtgtcatggagcatctc
aagctcttctggtctcgtatcaacattcccaagatgatccgggcctgcgaggaggctaac
ctatggccggagcttgttttcctgtactgccactacgacgaatgggacaatgccgccctt
gcgatgatggagcgtgctgctgatgcttgggagcatcactctttcaaggacatcatcgtt
aaggttgctaacctggaaatatactaccgtgccctcaatttctacctgcaagagcagccg
ctgctcctcaccgatctgcttcaggtgctgaccccccgcattgacgtgaaccgtgtcgtt
cgcatcttccaggcgtcagacaacattcctctgatcaagcctttcctcctgaacgtccag
tcccagaacaagcgggcggtcaacgacgcaatcaacgatctgctgattgaggaagaagac
tacaagcttctccgtgactcagtagataaccacgacaacttcgacgctgtggaacttgcc
cagcgcctggagaagcatgacctcatcttcttccgccagattgcagcgaacatttatcgc
aacaacaagcgctgggccaagtcgatagaattgtcaaagcaagacaagctctacaaggat
gccatcgagacggcagccatctcggccaagcccgatgttgtcgaggagctgctgcgctac
tttgtggacattggcagccgcgaatgctatgttggcatgctgtatgcttgctacgatttg
atccgtccagatgtgatcctggagttgtcatggcgccacggcctccaggacttcacaatg
ccttttatgatcaacttcctctgcgagcaaacacgtacgatagagatgctgaagaaggac
aacgaggagcggaaggcacgagaggtgacgcaaaagaaggacgaggacaacacgccgatt
ctaggcggatccaggctcatgctgacgcagggtccagcagcgccagcacctcctgtctac
ggacaagcgaatgggataacgccgcaggccacggggttccgtcctttctaa

DBGET integrated database retrieval system