KEGG   Aspergillus nidulans: AN4516.2Help
Entry
AN4516.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ani  Aspergillus nidulans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ani00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 835 aa AA seqDB search
MHPPSLQLLRALRTSISPKGAKPAIPLCANLNRFQSPIAVAFASPHRSNSSSNGSTHIRP
ARMVSRAHPSKPRTHDRGPPSKEDTQTDFAALNVLGNIPTPTTAVDACLDTGFHLDNGVK
ITGGDGVMLVGGEAFTWRPWMSKKDGTKNNMINAKGQFEVDEQVWGILDLVWPRPGIRVE
VLDTRNAAAQFNLLATERGVSEIAAAMIPIGWKGSSPTPTPTRGDIDPTISSIRYVPIMP
REEPLLAPRQSSEQSSIRNAEEEDALLTGERTHRGGSRRGWGFWREVGLFSWALIATVAV
IILAIVYQRESSWIQSHKKETWGPGGKPTGKRNLIFMVSDGMGPTSLTMTRSFKQLTQGL
PADEVLVLDRHILGTSRTRSSSSLVTDSAAGATAFSCGFKSYNGAISVLPDHSPCGTVLE
AASLAGYKTGLVVTTRITDATPACFASHANLRQYEDQIAEQEIGEHPLGRVVDLIMGGGR
CHFLPNTTDGSCRGDDRDLVAVAKEKGFSYIDDRKGFDSLNGGTEAKLPLLGLFAEKDIP
YELDRRTQNDVYPSLEEMARTALKILSHATEDSDQGFFLMIEGSRIDHAGHGNDPAAQVN
EVLAYDKAFAAVLEFLNDDSTPGVLVATSDHETGGLAVARQLHDTYPEYLWLPGVLANVS
HSSEYAAQKLQDYRRQKTDKPSQEAYTRDLLKKSLGIEDASQQEIDALLDPNNPIIPSYV
FADMQLIPPKGVDVNIYASSSRDAWPLQGNHENTEIGAFLADYLDLDVSAVTKRLQNSEF
WTAAESISVSESFNWLGNPLGDDVRTDGLDTYHGDFKRKRGFSGDADECGCGGVH
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaccttcgctccagctccttcgagcccttcgaacatccatctccccaaagggt
gccaaacctgccatccccctctgcgcaaacttgaaccgtttccaatcacctattgccgtg
gcatttgcttctcctcaccgcagcaatagcagctctaatggctctacgcacatccgccca
gcccgcatggtctcccgggctcacccatcgaaacctcgcacccacgaccgcggcccaccg
tcaaaagaggacacgcagactgatttcgccgcactgaacgtactcggaaacattccgacc
ccgacgactgctgttgacgcctgtctagatacgggcttccatctggacaatggcgtcaag
attacaggtggtgacggagttatgcttgtcggtggagaagcgtttacatggaggccttgg
atgagtaagaaggatgggaccaagaacaacatgatcaatgcaaagggacaatttgaagtg
gatgagcaggtttggggtatattggacttggtatggcctcgtccggggatccgggttgag
gtgctagatacaagaaacgctgctgcgcagttcaacctgctcgcgaccgagaggggagtt
tctgaaattgcggctgcgatgataccgatcggatggaaggggagttccccaactccaact
ccgactcgcggcgacatcgaccccaccatttcctctattcgctacgttcccataatgccg
cgagaagagcctcttctggctccacgccaatcatcagaacagtcatccattcgaaatgct
gaggaggaagacgccttgttgactggcgagcggactcaccgcggtggaagtcgtcgtgga
tggggcttctggagagaggtcggcctcttttcctgggctctaatagccaccgttgctgtt
attatccttgcaatcgtctatcagcgagagtcaagctggatacagagtcacaagaaagaa
acatggggtccaggaggaaaaccaaccggcaaacgcaaccttatcttcatggtctcggac
gggatgggcccaactagtcttaccatgactcgaagcttcaaacagcttacgcaagggctt
ccagctgacgaggtcctcgtgttggacaggcacattcttggtacttcacggacaaggtcc
agctcgagtctggtcaccgactcagcagccggagcgacggcattctcgtgcgggttcaaa
agttacaacggcgccatctctgtgcttcccgaccactcaccttgtggaacagtacttgag
gccgcatctttggctggttacaagactgggttggtggtgactacccgcatcaccgacgct
acaccagcttgcttcgcgtcgcacgcaaaccttcgacagtatgaagaccagatagcagag
caagaaattggtgaacacccactgggccgtgtggtagacctcataatgggtggtggacgg
tgccattttctgcccaatacaacggacggtagctgccgcggagatgatcgtgatctggtg
gcagtcgccaaggagaaggggttctcttacattgacgaccggaaaggttttgacagcctc
aatggtgggacggaagcaaagctaccgctgctgggactctttgctgagaaggacatccct
tacgaactcgatcgccgcactcagaatgatgtgtatccctctttggaggagatggctcgg
accgcgttgaagatccttagccatgctacagaggacagcgatcaaggatttttcctcatg
attgaggggtcccgcatcgaccacgcaggccatggtaacgacccagccgcgcaagtcaac
gaagtgctcgcctacgataaggcctttgctgcggtcctcgagttcctcaacgacgattcc
accccaggggtcctggttgcaacatccgaccacgaaactggaggactcgctgtagctcga
caactacatgacacttaccccgaatacctctggctccctggcgttctggccaacgtcagt
cactcctcggaatatgccgctcaaaagcttcaagactaccgccgccagaagaccgacaag
ccctctcaggaggcctacacgcgggacctcctcaagaaatctttaggcatcgaagacgcc
tcacagcaagaaatagacgccctacttgatcccaacaacccaatcatccctagctatgtc
ttcgccgacatgcaactaatccctccaaaaggtgtcgacgtaaatatctacgcttcctcg
tcaagagacgcctggccgctacaaggtaaccacgaaaataccgaaatcggcgccttccta
gccgactacctcgacctcgacgttagcgccgtcacaaaacgcctccagaactctgagttc
tggaccgccgctgaaagcataagcgtaagcgagagcttcaactggctgggcaacccgctc
ggcgacgacgtccgcaccgacggactcgatacgtatcatggggactttaagcggaagcgc
ggattcagcggtgacgctgatgagtgcgggtgtggtggtgttcattag

DBGET integrated database retrieval system