KEGG   Aspergillus nidulans: AN4639.2Help
Entry
AN4639.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ani  Aspergillus nidulans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 1431 aa AA seqDB search
MRDPTVDMEQRNTSPHQASSLQAEAPRRTQKSVRVAFGPDLETHIPPRQRSPAPISNHHR
SFTTVEHHKPPPARPTSSSGENTTPTEGNSRFTSDQDSSSSARPTAALKRAKSDYGPRGG
FDKPVVVDNEDEEDFAMRHGWQEEYTSSEYLKVLHSNFYMYFTEKRHETNGFPRDPVGSW
PSQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPTAKLECWVDPTSTTGGGNNKLMEQ
IGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCVSLRRNAKDERVLFHYNGHGVPLPTQS
GEIWVFNKNYTQYIPVSLYDLQQWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENLEQK
RLDPNAIVQNYGDCIILAACQKNESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQS
NIRIDDFRVPGRLQDRRSPLGELNWIFTAITDTIAWKTLPRALFKKLFRQDLMVAALFRN
FLLSERIMRTYKCQPISSPELPETHNHPLWKSWDLAVEMVLAQLPALIDHEEGRRQYEYQ
HSTFFAEQLTAFEMYLSSGPTEKSPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAV
HLALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNP
SSPIPVGNASEHRAMCAFIVSIFCKNYTQGQNVCLSSDLFESCLIHLMDVENPLLRQWSC
LCISMLWSDFPEAKWMGIRCSAPMRLCELNFDPVPEVRAAMLHALMTFLGIPDLTDQVAQ
IEESLALAVLPMASDGSVIVRKELLVFFSTFVKRYQNKFLVAAYEELQDEKLNLLGKLGL
DSSPPAETGTAGKPQPLSKNTTFGTIWKQLLILSVDPHPDIAQDAGIIVDYMHQLLLESP
MAALTGRLRKEILDLSNQVDQQSQVREKPNLKKAAPPPPPPTAPPKQEGYLSLSLRRTAS
VAASLKNLAFGGPSQGESSQGSEASTSPQSRAPATPRGRAPPEWTRPPEVNDQLAPATTY
QQAPVPTSRGFERRDSSVAPSIPLYFREPQMKPNEPDEPGSADYNERLWRRSRNEKIISE
TQPLKGKAGSSRWDNSIALLSNATQPLKMCFHQFEDHIAVADDRDTIAIWDWQNHKRLNR
FSNGNPLGSKINEVRYINEDDQALLMTGSSDGVLKVFRNYESAKDVEIVTAFRALPELIP
SNRNAGLVLDWQQGQGKALVAGDVKVIRVWNAATEVCTTDIPARSGSCITSLTSDQVAGN
IFVAGFGDGAVRVFDQRLKPTASMVKVWREHKQWITNVHMQRGGLRELISGSRNGEIRLW
DLRMDNPISTIYGTRDTLRTLSVHEHAPVFMVGTNRHEVKTYNVDGTHLSTFEPYSSFLH
HNRSSPISSTAFHPHRTLFACAALNDNHINLHGRQFVCPALVKQSNGLEYL
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atgagggacccgacagtagatatggagcaacgtaatacatcaccgcaccaggcttccagt
cttcaggctgaggccccgaggaggacccagaagtccgtccgagttgcctttggccctgac
ttggaaacgcatatcccacctcgccaaagatcccctgcaccgatttcaaatcaccatcgc
tcatttaccactgtcgaacaccacaagcctccaccggctaggccgacgagctcttctggc
gagaacacaacgcctaccgagggcaattcgcggtttacttcagaccaagattccagtagt
agtgcacggccaacggcggctctgaagagggccaagagtgactatggaccccgcggaggt
ttcgataagcccgtggtcgtcgataacgaggatgaggaggactttgcgatgaggcatggg
tggcaggaggaatacacgtcgagcgagtacctcaaggtgcttcattcgaacttctacatg
tactttacggagaaacgtcacgagacaaatggatttccgagagaccctgttggaagctgg
ccatcccaggactggcggatgaaggaccgcctcaagactgtttctgctgcgttggcgatt
tgtctgaacatcggtgttgatcctccggatgtcgtcaagacaaatccaaccgctaaactc
gaatgctgggtcgacccgacatccaccaccggcggcggcaacaacaagctgatggagcaa
attggaaaaaaactgcaagagcaatacgagacacttagtcttaggacgcggtacaagcaa
tacctcgacccttctgttgacgaaaccaagaagttttgtgtatcgctccgccgaaacgcc
aaagacgaaagagttctcttccactacaatggtcacggtgtcccgttgcccactcagtcc
ggagagatatgggttttcaacaaaaattacacacagtacatccctgtgtccttgtacgac
ctacaacaatggcttgcggggcccagtctttttgtgttcgatgtttctcatgcagggaac
atagtccaaaacttccacacctttgttgagaaacacgagaaagaaaacctcgagcagaaa
aggcttgatccgaatgctatcgttcagaactatggagactgcatcatccttgcggcgtgc
caaaagaatgaatcccttccgacgaatccagatctcccggcggatttgtttacatgctgc
ctgaccacaccgatcgagattgcgttgcgctatttcattctccaaaacccacttcaatcc
aatatccgaatcgacgactttcgggttcccggtcgcttacaggaccgcagaagtcctctc
ggagagttgaactggatcttcacggccatcaccgacacgattgcgtggaaaactctacca
cgagccctcttcaagaaacttttccggcaagaccttatggtggcggcattgttcaggaac
tttctgctgagcgagcgcatcatgcgcacatacaaatgccaaccaatctcatcaccagaa
ctcccagagacccataatcaccccctctggaaaagctgggacctggcggttgaaatggtt
cttgctcagctgcctgcccttatcgatcatgaggaaggtcgcagacaatacgagtatcaa
cattccacattcttcgcggaacaacttactgcgtttgagatgtacttatcatctggccca
accgagaagagcccaccagatcagttacccatcgttctgcaggtccttttgagtcaggcg
cacaggttgagagccctgatcctgcttagcaagttcctcgacttaggaccatgggctgtc
cacttggctttgagcattggtatattcccctatgttgtgaagcttctgcagtcggcggct
caggagttgaaaccggtcatggtattcatttgggcaagaatcatggctgtcgaccacaca
gtccagaatgaccttttgaaggacaacggcatccactacttcatctccatccttaaccca
tcctcacctattcccgtgggtaacgctagcgaacaccgagccatgtgtgccttcattgtt
tcaatattctgcaagaattatacacaaggacagaacgtatgcctatcatccgacctcttc
gaatcctgtttgatacatctgatggatgttgaaaaccccctgctgcgacagtggtcgtgc
ctctgtatcagtatgctgtggtcagactttccggaggccaagtggatgggaattcggtgt
tctgcgccgatgagactttgcgaactaaacttcgaccccgtcccagaagtcagggccgca
atgcttcatgccctgatgaccttcctcggtatccccgatctgaccgatcaggtggcacag
attgaggaatctttagcccttgccgtcctaccgatggcttccgatggtagcgtgattgtc
aggaaagagctccttgtgttcttttcaactttcgtgaagcgctatcagaacaaattcctt
gttgctgcttacgaggaacttcaggatgaaaagctgaaccttctcggtaaactaggctta
gatagctctccgcctgcagagacgggtactgcaggcaagcctcagccactgtccaagaac
acaacatttggcacaatctggaagcaacttctgattctctccgttgatccccatcctgac
attgcgcaggatgcggggataattgtggattacatgcatcagttgttactcgaatctcct
atggccgcgctaactggacgacttcgcaaggaaatattggacctctcaaatcaagttgac
caacagtcccaggttcgtgaaaagccgaatctgaagaaggctgcgccgccgccgcctcct
cccaccgcgcccccgaagcaagaagggtacctctcattgagccttaggcggactgctagt
gtagcagcatcgctaaaaaatctcgcatttggcggcccttcgcagggagaatcatcccaa
ggatcggaggcatcaacatcaccccaaagtcgtgcacctgccaccccacgagggcgagct
cctccggaatggactcggccacccgaggtcaacgaccaacttgctcctgcaacaacatac
caacaagcaccagttcccacttcgcgtgggtttgaacgcagagattcatcagttgcccca
agcattccactatacttccgcgaaccgcaaatgaaacccaatgaacccgacgagcccggt
agcgcggattacaatgaacgtctctggaggcgcagccgcaacgagaaaatcatttcggag
acccagcccctgaaaggaaaagcaggcagcagccgctgggataactcgatagcgctgtta
tcgaacgccactcagcccctaaagatgtgctttcatcagttcgaggaccacattgccgtg
gccgatgatagagatacgattgcgatctgggattggcagaatcacaaacgcctcaaccgt
ttctccaacgggaacccattgggatccaagatcaacgaagttcgttacataaacgaggat
gaccaagctcttctgatgacagggtcgtcggatggcgtgctcaaagtgttccgcaactat
gaatcagccaaagacgtcgaaatcgtgaccgctttcagagcattaccggaactaatccct
agtaaccggaacgccggccttgttctcgactggcagcagggtcaaggtaaagctctggtc
gccggtgatgtcaaagtcatccgggtgtggaatgcggcaacagaagtctgcacgactgat
attcccgcccgctccggctcctgcatcacgtctctaacttctgaccaagttgcgggcaac
atcttcgtggccggctttggcgacggcgcagtccgcgttttcgaccagcgcctcaaaccc
acagcgtcaatggtcaaagtatggcgcgaacataaacagtggatcaccaacgtccatatg
cagcgcgggggcctcagggaactcatctccggcagtcgaaacggcgaaatcagactttgg
gatctgcgcatggataatcccatctcaacgatttacggcacaagagataccctgcgcaca
ctgagcgtccacgaacacgcgcctgttttcatggtcggcacaaaccgccatgaagtaaag
acttacaacgttgacggaacccacctttctaccttcgagccttactcaagcttcctccac
cataaccgctcctcgcccatctccagtacagcctttcacccgcaccgcaccctcttcgcc
tgcgccgcgctcaacgataatcatatcaatctgcatggccgtcagttcgtatgtcctgca
ctcgtaaagcaaagcaacggactcgagtatctctga

DBGET integrated database retrieval system