KEGG   Aspergillus nidulans: AN4668.2Help
Entry
AN4668.2          CDS       T01016                                 

Definition
similar to MpkCp
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ani  Aspergillus nidulans
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AN4668.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AN4668.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AN4668.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 347 aa AA seqDB search
MAEFIRSDILGTTFETTSRYANLQPVGLGTAGVVCSAYDLISEQVVAIKKMMKPFHSTSV
AKRTYREVKLLRHLRHDNLINMSDIFISPLEDVYLVTELLGTDLHRLLNGKPLESKFAQY
FTYQILRGLKYIHSAGVIHRDLKPGNLLINENCDLKICDFGLARVQEPQMTGYVSTRYYR
APEIMLTWQRYGSKVDLWSVGCILAEMLLGRPLFPGTDHINQFWLITDLLGNPPDEVIDR
ITTNNVRNPAPDLQPSNHLEPANGNRRIDSSGALNLLDNLLVFDPDRRISAEQGLMHPWM
APYHDPTDEPVATEQFDWSFNDADLPLDTWKIMMYVHHCSDVVSFTL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcattcgctctgatatcttgggaaccacctttgagaccaccagcagatat
gcgaacttgcagcccgttggcctcggcactgcaggagttgtatgttccgcttacgacttg
atctcggaacaagtggttgcgatcaagaagatgatgaagccatttcacagcacttcggtt
gcgaagcggacatatcgagaagtgaaacttctgaggcatcttcgacatgataatctgatc
aatatgagcgatatcttcatctcgccactagaagatgtgtatcttgtcaccgaactctta
gggacagatctgcacagactgctcaacggaaagccactcgaaagcaaatttgcccagtac
ttcacctatcaaatcctgcgcggactgaaatacatacactcagcaggcgtaatccaccga
gacctcaaaccgggaaatctcctcatcaatgagaactgtgatcttaagatctgcgatttt
gggctggcccgtgtccaggagccgcagatgactggttatgtttcaacaagatactaccgc
gcgccggagatcatgctgacatggcaacggtatgggagcaaggttgatctgtggagtgtg
ggctgtattcttgcggagatgttgctgggccggccgctgtttccgggcactgaccacatt
aaccagttctggctgattacagacctgctaggaaatccgccggacgaggtgattgaccgg
ataacaacgaataatgtacgtaaccccgccccggatcttcaaccctccaaccatctggag
cccgctaacggaaatcgccggatagactcgtcgggtgcactaaaccttctcgacaacctc
ctcgtctttgaccctgaccgacgtatctccgccgagcaggggctcatgcacccttggatg
gccccctatcacgatcccacagatgaacccgtcgcaactgagcaattcgactggtctttt
aatgacgctgatctacctttggatacgtggaaaattatgatgtacgttcaccactgttcg
gatgtagtttctttcacgctgtaa

DBGET integrated database retrieval system