KEGG   Aspergillus nidulans: AN4668.2Help
Entry
AN4668.2          CDS       T01016                                 

Definition
similar to MpkCp
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ani  Aspergillus nidulans
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ani04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 347 aa AA seqDB search
MAEFIRSDILGTTFETTSRYANLQPVGLGTAGVVCSAYDLISEQVVAIKKMMKPFHSTSV
AKRTYREVKLLRHLRHDNLINMSDIFISPLEDVYLVTELLGTDLHRLLNGKPLESKFAQY
FTYQILRGLKYIHSAGVIHRDLKPGNLLINENCDLKICDFGLARVQEPQMTGYVSTRYYR
APEIMLTWQRYGSKVDLWSVGCILAEMLLGRPLFPGTDHINQFWLITDLLGNPPDEVIDR
ITTNNVRNPAPDLQPSNHLEPANGNRRIDSSGALNLLDNLLVFDPDRRISAEQGLMHPWM
APYHDPTDEPVATEQFDWSFNDADLPLDTWKIMMYVHHCSDVVSFTL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcattcgctctgatatcttgggaaccacctttgagaccaccagcagatat
gcgaacttgcagcccgttggcctcggcactgcaggagttgtatgttccgcttacgacttg
atctcggaacaagtggttgcgatcaagaagatgatgaagccatttcacagcacttcggtt
gcgaagcggacatatcgagaagtgaaacttctgaggcatcttcgacatgataatctgatc
aatatgagcgatatcttcatctcgccactagaagatgtgtatcttgtcaccgaactctta
gggacagatctgcacagactgctcaacggaaagccactcgaaagcaaatttgcccagtac
ttcacctatcaaatcctgcgcggactgaaatacatacactcagcaggcgtaatccaccga
gacctcaaaccgggaaatctcctcatcaatgagaactgtgatcttaagatctgcgatttt
gggctggcccgtgtccaggagccgcagatgactggttatgtttcaacaagatactaccgc
gcgccggagatcatgctgacatggcaacggtatgggagcaaggttgatctgtggagtgtg
ggctgtattcttgcggagatgttgctgggccggccgctgtttccgggcactgaccacatt
aaccagttctggctgattacagacctgctaggaaatccgccggacgaggtgattgaccgg
ataacaacgaataatgtacgtaaccccgccccggatcttcaaccctccaaccatctggag
cccgctaacggaaatcgccggatagactcgtcgggtgcactaaaccttctcgacaacctc
ctcgtctttgaccctgaccgacgtatctccgccgagcaggggctcatgcacccttggatg
gccccctatcacgatcccacagatgaacccgtcgcaactgagcaattcgactggtctttt
aatgacgctgatctacctttggatacgtggaaaattatgatgtacgttcaccactgttcg
gatgtagtttctttcacgctgtaa

DBGET integrated database retrieval system