KEGG   Aspergillus nidulans: AN5105.2Help
Entry
AN5105.2          CDS       T01016                                 

Definition
similar to dolichyl-phosphate-mannose:protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ani  Aspergillus nidulans
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AN5105.2
Enzymes [BR:ani01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     AN5105.2
Glycosyltransferases [BR:ani01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AN5105.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 740 aa AA seqDB search
MAEIGFASTTGASFAPDVRRRNVRTEGQARTSGLIEPDDKKHKQRPNSYLSALADWEPLI
APILLTVLSMFTRMYRIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLSGL
LAGYNGSFEFKSGETYPEDLNYTFMRLFNAAFGVVCVPLAYLTARELGFRRGTVWLVSLM
VLFENSYATISRFILLDSMLLCFTFTTTFCWAKFHRLQHASFSIEWFTWLFLTGVSIGCV
CSVKWVGLFCTALVGLYTIEDLWNKFGDLKMSEATLAKHFAVRVVGLILIPALVYIFSFY
IHFLILENSGPGDAQMSSLFQANLKGTQVGKDSPLEIAFGSRVTLKNMGYGGGLLHSHVQ
TYPEGSSQQQVTCYHHKDANNDWFIYPNRKEPQYDAEAPLRFVGDGDVIRLIHGQTGRNL
HSHNIPAPITKNHHEVSCYGNLTIGDDKDHWKVEVVDDVASRDRSRIRTLTTAFRLRHAV
LGCYLRAGNTNLPQWGFKQIETTCVKENKPRDVYTHWNIETHTNDRLPPGDPGSYKSPFF
KDFVHLNVAMMTSNNALVPDPDKQDDLASKPWQWPILNVGLRMCSWDEKVVKYYLLGNPV
VYWGSTLSLAVFGLLTLWYLVRWQRGYNELSQADIDHIHYAGLYPVLGWFLHYVPFIAMA
RVTYVHHYYPALYYAILTFGFCVDWLTKTLNTKVRFLVYGLLYALVAGVFVYFRVIVFGI
EGPSQQWRHLNWLSGWRIAN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattggctttgcatcgaccactggtgcgagctttgcccccgatgtgcgacgt
aggaatgttcgcactgagggacaggctaggacttcaggcttgattgaacctgacgacaag
aaacacaaacagcggcccaattcttatctctccgctctggcagactgggaacctctaatt
gcaccgattcttttgacagttttgtcaatgtttacgcgtatgtaccgaatcggccgctca
aacatcgtgacctgggacgaggcgcacttcggaaagtttggatcacattacctgaagcgc
gaattctactttgatgttcaccctccgttggggaaaatgcttgtcggcttgtcgggcctt
cttgccggttataacggatcattcgagttcaaatctggcgaaacatacccggaagacctt
aactacacatttatgcgcctattcaacgctgcctttggcgtggtgtgcgttccgcttgcc
tacctaacggcacgcgagcttggttttcgtagaggtactgtttggcttgtgagcctcatg
gtgcttttcgagaattcatatgccactatttcaagattcatattgcttgactctatgctc
ctttgcttcacattcacgaccacattttgttgggcaaaatttcatcgtctccagcatgcg
agtttctctattgagtggttcacctggctatttctgaccggcgtgagtattggctgcgtt
tgtagtgtcaaatgggttggccttttctgcactgcacttgttggcctctacaccattgaa
gacctgtggaataaatttggtgatttgaagatgtctgaggcaacgttagctaaacatttt
gcggtacgcgtggtgggcttgattctaataccagctctggtatatatcttttcgttctac
atccacttcctgattttagagaacagtggcccaggcgatgcgcagatgagctcgttgttt
caagcgaatctcaaaggtacccaggtgggcaaagacagcccgctggaaattgcattcggc
tcaagggtcactttgaagaatatgggttacggcggcgggctacttcattctcatgtccag
acgtatcctgaaggttcgtcccagcaacaggttacttgctatcaccacaaggacgcgaac
aacgactggtttatctatcctaatcgcaaggagccccagtacgatgcagaggcacctctt
aggtttgtcggtgacggtgatgtcattcgtctgatccacggccagacaggccgtaacctt
cattcccacaacatccccgcaccaataaccaagaaccaccatgaagtttcctgctatggc
aatttgactattggagatgataaggaccattggaaggttgaggttgtcgatgatgttgct
tcaagagacaggagtaggatcagaactctgacaactgcgttccgtttgcgacatgcggtt
ttgggttgttatctacgcgccgggaacactaatcttcctcagtggggtttcaagcaaatt
gaaacaacttgtgtgaaggaaaacaaaccccgtgacgtttatacgcactggaatattgaa
acccataccaacgaccgacttccccccggtgatcctggatcgtacaagtctcctttcttc
aaagactttgtacatttgaacgttgcgatgatgacgtcgaacaatgctttggtgcctgat
cctgacaagcaggacgatcttgcgtcgaaaccttggcaatggcccattcttaatgtcggt
ctacgcatgtgctcttgggacgaaaaagtcgtcaaatactatctacttggaaaccctgtt
gtctactggggtagtaccttgagtttggctgtctttggactgctgaccttgtggtacctt
gtgcgatggcagcgcggctacaacgagcttagccaggcagatattgaccacattcactat
gccggcttgtaccccgttctcggttggtttctgcattatgtgcctttcatcgctatggcg
cgagttacctatgtccaccactattaccccgcgctatactacgctatcctgacattcggg
ttctgtgttgattggcttaccaaaactttgaacaccaaggttcgattcttggtgtatggg
ctactctatgctttggtcgctggggttttcgtctacttcagggtgattgtgttcggcatt
gaaggtccaagccaacagtggcgtcacttgaactggttgagcggttggcgaatcgctaac
taa

DBGET integrated database retrieval system