KEGG   Aspergillus nidulans: AN5186.2Help
Entry
AN5186.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AN5186.2
Peptidases [BR:ani01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AN5186.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 840 aa AA seqDB search
MPHGQPPIPAPRRQQDVPYASGPPNMRSPPAYMGYPPQMNGHPPPAAFSPQQYPQWYTPF
PPMQMPPRPHFNPYAPAFISSYPPSQPMMAPAHMPPQPLPLQPRASTPFQNPMSPSVGPA
PAFIPSQTQSPVVIPVHSTPSPAMSSSPAPAPVNAVPPPKEPFRAPLPWLSIPDSPFPAR
APRRQRKTRNLQASSLSVELPAKDGQRIQNEEPSKPQGTQTQTPSEPQTPTLSAAPSVAD
STQPTTPSSAVPSSSARQSKGSKATVPVVPVVPVVPVSNTPRREKGDAGSFETPKSAPEA
ANTSAEKPIASAEEPAESKPVESAKPAAPKSWADLVRNKNLARNAASQSAPSGVVNGVSK
SQSVADVLLNLGDDVSQYSDKVTFLEPRGLVNTGNMCYMNSVLQILVSCVPFYQFLDHIG
KRASHSFHSDFPMVDALIMFMKEFRVIDAARNEEQLRMRLKANELEQYGEAFIPEFVYEV
IRQLPRFRDMRRGHQQDAQEFLGFLLEEMHEECARATSANSSTEPASTDSENGDGWLEVG
HKQKPAVTRSSGHIASESPITKIFGGKIRSEFRVPGNKASVTLEPYQPLQLDIGAPEIHN
IVDALKGLTKPESIQGDFNSSRGPNVTATKQVFIESLPPVLILHLKRFQYDSVTHGTQKI
WKKIGYPLDLEIPREVFPPHRRNVMMAQGGLPKYRLTGVIYHHGKNASGGHYTVDVRRQD
GREWIRLDDTVIRRIKSEDVAEAGGEEDPKVLAAALEQHKRDKDPANIYDHINQGDQSDD
ERGWSQVNGTGSGNSSKKSASAINGTPSQSNTSSGVRTPMGRYSTRDNKVAYLLFYERIP
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgccccatgggcagccacccattcctgcgcctcggcggcagcaggacgttccctacgcg
agtggccctcccaacatgcggtcgcccccggcatacatgggctatccgcctcaaatgaac
ggccatccccctccagccgcgttttccccgcagcaatacccccaatggtatacacctttt
ccgccaatgcagatgccacctcgtccacacttcaatccatatgcaccggccttcatttca
tcgtaccccccttcccagcccatgatggcaccggctcacatgccgccacaaccgcttcct
ttacaaccaagagcgtcgacgccatttcagaacccgatgtcaccgtctgttggcccggcc
ccggcattcatcccgtcgcagacccagtctcctgtagtgatccccgtccactctacaccc
agcccggccatgtcttcgtcgcctgctcccgccccggttaacgccgtgccgccgcccaaa
gaacccttccgcgcaccgctcccgtggctttctattcccgatagtcctttcccggccagg
gctccccgcagacaacgaaagactcgcaacttgcaagcttcctctctttctgtggagctt
cctgccaaggatgggcaacgaattcagaatgaagaacctagcaaaccccagggcactcag
acacagacaccttctgaaccgcaaactccaactttgtcggctgctccctctgttgcggat
tccacccagcccacgactccatcttctgctgtgccgagctcatctgctcgtcagtccaaa
ggatcaaaagcaacggtccctgttgtgccggtggtcccggttgttcccgtttcaaacacc
cctcgtcgcgaaaaaggcgatgctggctcctttgagacgcctaaatcagccccagaagcc
gccaacacctctgctgagaaaccgattgcgtccgcagaggaacccgctgagagcaagccg
gtggagtccgccaaacctgccgcgccaaagtcttgggcggacttggttcgaaacaagaac
cttgctcgtaacgcagctagccagagtgctccatcgggtgtggtcaacggcgtctccaag
agccagtccgttgccgatgtcttactcaatctaggagacgatgtttctcagtatagcgat
aaagtgaccttccttgaaccccgagggctcgtcaatactggtaatatgtgctacatgaat
tcggtgcttcagattttggtttcatgcgtgccgttctatcagttcctggatcatattggg
aagcgcgcgtcccacagtttccacagcgactttcccatggttgacgctctaatcatgttc
atgaaagaatttcgagtcattgatgccgcccgcaacgaagagcagttgcgaatgaggctg
aaggcgaacgagctcgagcaatacggagaggcttttattccagagtttgtgtatgaagtt
atccgccaactaccccgtttccgagacatgcgacgcggccaccagcaagatgcgcaggag
ttcctgggttttcttcttgaagaaatgcatgaagaatgcgctcgcgctactagtgccaat
tcctcaaccgagcctgcatctactgatagtgagaacggtgacggctggttggaagttggc
cacaaacaaaagccagccgtcacacggtcttccggacacattgcctctgaatctccaatc
acaaaaatctttgggggcaagattcgatccgagttccgcgtacctggtaataaggcctct
gtcactcttgaaccgtatcagccgctgcaacttgacatcggcgccccagagatccataac
attgtggacgcactaaagggcttgaccaagccagaaagtattcagggagatttcaattct
tcgcgtggtccaaatgtgactgcgaccaagcaagtcttcattgagagcctccccccggta
ctcatccttcaccttaagcggttccagtatgacagcgtcacccatggcacgcagaagatc
tggaagaagattgggtatcctttggacttggaaatccctcgagaagtgttcccgcctcac
agacgtaatgtcatgatggctcaaggtggacttcccaaatatcgtctcactggagtcatc
tatcaccacggcaagaatgccagcggtggtcattacaccgtcgatgttcgtcgccaggat
ggccgcgagtggatccgccttgacgacaccgtcatccgtcggatcaagagcgaagacgtt
gcagaggccggtggagaagaagatccaaaggtgcttgcggcggcattggagcagcataag
cgtgataaagatcctgccaatatttatgaccacatcaaccagggcgaccagtccgacgat
gagcgaggttggagccaggttaacgggactggctctgggaactcgagcaagaaatctgcg
tctgctatcaatggcactcccagccagtccaatacatcctctggtgttcgtaccccgatg
gggcgttatagcactcgtgacaacaaggtggcctacctgctgttttatgagcgcattcca
tga

DBGET integrated database retrieval system