KEGG   Aspergillus nidulans: AN5444.2Help
Entry
AN5444.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ani  Aspergillus nidulans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AN5444.2
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AN5444.2
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AN5444.2
Enzymes [BR:ani01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AN5444.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 443 aa AA seqDB search
MLVSVKSHFRPRYEPYSSRWRQSKKGRQTLPRVSEEKYLKPVNDSFNLNLGDLLQSPLWF
KHHVDIPAVDMPARLGRFGGQFAPELQMDLLLDLPSVFHSVLSDNRFWTEFSASPFLRPS
PLHLAHSLTKAVGGANIWLKRDDLNPFGSYQTRNIVGQILFAQHIGKTEISMECGFAGHG
LFCATMCARMNMKCTILMGASDIAAQPDAVEEMKQLGATVVSVQCSISDDGSGTLRAATN
EALRYSLTRLNSTYHISTGTVGPHPLPTITRTFQSLLGQEIKICSSELPGRGRRKNNFRP
SALVSTSGAAALGMFAPFISDPAVRLIAVEAADAAPLTHGSPGVMYGCKTLLLQDENGQI
LPSHSISPDLNFPCAGPELAHWRDLGRLETVTASSEEAVRGLRILCESEGIVPGLATSHA
VLETVRVARQLGIGKDVVLLISG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgtctgttaagtctcacttccgccctcggtatgagccttactcaagtcgatgg
agacagagcaagaagggcagacaaactcttcctcgtgtgtctgaagagaaatacctcaag
ccagtcaacgacagcttcaacttgaacctcggggatctcctgcaaagtcctctgtggttt
aaacatcatgtcgacattccggctgttgatatgcctgcacgtcttggaaggttcggcggt
caatttgctccagagttgcagatggacctcctcctcgatcttcctagcgtattccacagc
gtcctctctgacaaccggttctggacagagttctctgccagccccttcctccgtcctagt
cctcttcatttagcccatagcttgacgaaggccgtcggcggggcgaacatctggctaaag
cgcgatgacctcaaccctttcggcagctatcaaacccgcaacatcgtcggccagattctt
ttcgcccagcatattggaaagacagagatttccatggaatgtggatttgcagggcatggt
ctcttctgtgctaccatgtgtgcgcgcatgaatatgaagtgtacaatcctcatgggggcc
tctgatatcgccgcacaacctgacgccgttgaggaaatgaaacagctcggcgcgactgtt
gtcagcgttcaatgctcaatcagtgacgatggcagcggcaccctccgagctgccaccaac
gaagcccttcgctactcgttgactcgcctcaattcgacataccatatcagtactggcacc
gtcggcccccatcccctcccaaccatcacccgcaccttccaatcgctactcggccaggag
atcaagatctgcagctcagaacttccgggcaggggacgtcgaaagaacaacttcagaccg
tccgcccttgtatccacttccggtgccgcagctctaggcatgtttgcgcctttcatttcc
gacccagccgtccgcctcattgctgttgaagcagcggacgcggcaccactaactcacggc
tcgccgggcgtaatgtacggctgtaagactcttctattgcaagacgagaatggccagatt
ctgccgtcgcactctatatctccagatctgaatttcccttgcgcaggccctgaattggct
cattggagggatctcgggcggctagagacggttacggcgtcgagcgaagaagctgtaagg
ggattgaggatattgtgtgagagcgaggggattgtgcctggtctggctacatcacatgca
gttctagagactgttagggttgctaggcaattggggattggtaaggatgttgttctgctt
atttcgggctga

DBGET integrated database retrieval system