KEGG   Aspergillus nidulans: AN5444.2Help
Entry
AN5444.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ani  Aspergillus nidulans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AN5444.2
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AN5444.2
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AN5444.2
Enzymes [BR:ani01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AN5444.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 443 aa AA seqDB search
MLVSVKSHFRPRYEPYSSRWRQSKKGRQTLPRVSEEKYLKPVNDSFNLNLGDLLQSPLWF
KHHVDIPAVDMPARLGRFGGQFAPELQMDLLLDLPSVFHSVLSDNRFWTEFSASPFLRPS
PLHLAHSLTKAVGGANIWLKRDDLNPFGSYQTRNIVGQILFAQHIGKTEISMECGFAGHG
LFCATMCARMNMKCTILMGASDIAAQPDAVEEMKQLGATVVSVQCSISDDGSGTLRAATN
EALRYSLTRLNSTYHISTGTVGPHPLPTITRTFQSLLGQEIKICSSELPGRGRRKNNFRP
SALVSTSGAAALGMFAPFISDPAVRLIAVEAADAAPLTHGSPGVMYGCKTLLLQDENGQI
LPSHSISPDLNFPCAGPELAHWRDLGRLETVTASSEEAVRGLRILCESEGIVPGLATSHA
VLETVRVARQLGIGKDVVLLISG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgtctgttaagtctcacttccgccctcggtatgagccttactcaagtcgatgg
agacagagcaagaagggcagacaaactcttcctcgtgtgtctgaagagaaatacctcaag
ccagtcaacgacagcttcaacttgaacctcggggatctcctgcaaagtcctctgtggttt
aaacatcatgtcgacattccggctgttgatatgcctgcacgtcttggaaggttcggcggt
caatttgctccagagttgcagatggacctcctcctcgatcttcctagcgtattccacagc
gtcctctctgacaaccggttctggacagagttctctgccagccccttcctccgtcctagt
cctcttcatttagcccatagcttgacgaaggccgtcggcggggcgaacatctggctaaag
cgcgatgacctcaaccctttcggcagctatcaaacccgcaacatcgtcggccagattctt
ttcgcccagcatattggaaagacagagatttccatggaatgtggatttgcagggcatggt
ctcttctgtgctaccatgtgtgcgcgcatgaatatgaagtgtacaatcctcatgggggcc
tctgatatcgccgcacaacctgacgccgttgaggaaatgaaacagctcggcgcgactgtt
gtcagcgttcaatgctcaatcagtgacgatggcagcggcaccctccgagctgccaccaac
gaagcccttcgctactcgttgactcgcctcaattcgacataccatatcagtactggcacc
gtcggcccccatcccctcccaaccatcacccgcaccttccaatcgctactcggccaggag
atcaagatctgcagctcagaacttccgggcaggggacgtcgaaagaacaacttcagaccg
tccgcccttgtatccacttccggtgccgcagctctaggcatgtttgcgcctttcatttcc
gacccagccgtccgcctcattgctgttgaagcagcggacgcggcaccactaactcacggc
tcgccgggcgtaatgtacggctgtaagactcttctattgcaagacgagaatggccagatt
ctgccgtcgcactctatatctccagatctgaatttcccttgcgcaggccctgaattggct
cattggagggatctcgggcggctagagacggttacggcgtcgagcgaagaagctgtaagg
ggattgaggatattgtgtgagagcgaggggattgtgcctggtctggctacatcacatgca
gttctagagactgttagggttgctaggcaattggggattggtaaggatgttgttctgctt
atttcgggctga

DBGET integrated database retrieval system