KEGG   Aspergillus nidulans: AN5589.2Help
Entry
AN5589.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ani  Aspergillus nidulans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AN5589.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AN5589.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN5589.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 567 aa AA seqDB search
MRKNPFDMSELDAEIEANEEQQHQVRIHARQSIDGERSLLQDEERRQDDLKDRFIGAIDQ
GTTSTRFIIFDCVGNPVAKYQAEYRQLHEHSGWHEQDPYEMVDSVYTCIEEAMKTFLALG
HSKSDIEAIGLTSQRETVLCWDWETGEPLCPSIAWPDTRTKALVRELKAQKGADELKNIC
GLPLSTYPSSVSLVWLLRNNEAVKQAYEEGRLAFGTVDSWLIYNLNGGLEGRHHVTDVTN
ASRTMLMNLETLDYDKRLLDFFGLDPKKIRLPKILPSSDPEGFGYVRSGPLEGVPITSDL
GDQSAALVGHCAFTPGMAKNTYGTGCFLLYNVGEKPVISKHGLLGTVGFQLGKNRKPVYA
LEGSVAVAGSGVSFLMNNMGFFRDSRKVSDLAAMVPDNGGCVFVTAFSGLFAPYWIDDAK
GTIFGITQHTQRGHIARATMEAACFQTKAILDAMEMDSGHSLSQLAVDGGMSNSDICMQT
QADIIQIPVERPAMHETTALGAAIAAGFAIDIWKEFDELKNMNRANRTSFTPAISREQSQ
KMYKQWTKAVEMSRGWVDTKEMGGEDD
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagaacccttttgacatgtctgagctcgacgccgaaatcgaggccaacgaagag
cagcaacaccaagtccgcatccatgcccgccaatcaattgacggcgaacggtcgttgttg
caggatgaggagcgtcggcaagacgacttgaaggatcgtttcattggtgccattgaccag
ggtactacgagtacgcggttcattattttcgactgcgtgggcaaccccgttgccaaatac
caggcggaataccgccaactccacgagcattcaggatggcacgaacaagatccgtatgag
atggtagattccgtctacacgtgtattgaagaggccatgaaaacattcctcgcccttggt
cattctaagtcagatattgaagcaatcggtctcactagccaacgtgagacagtcctctgc
tgggattgggaaactggtgaacctctatgtccctcgattgcttggcccgatacccgaaca
aaagcccttgttcgagaattgaaagcacaaaaaggcgccgatgaactgaagaacatttgc
ggtctgccactatccacatatccttcgtctgtctcattggtctggctactccgcaacaac
gaggccgtgaaacaggcgtacgaggaaggacgacttgcttttggcactgtcgattcatgg
ctcatctacaacctgaacggtggtctagagggtcgccaccacgtaacggatgtgaccaat
gcctctagaaccatgttgatgaacctcgagacgctcgattatgataaacgacttctggac
ttctttgggttagaccccaagaagatccggctgcccaagattcttccatcctctgaccct
gaggggttcggatatgtacggtcaggccccttagaaggagttccgatcactagcgacctt
ggagatcagtctgcggcgcttgttggccactgtgcgtttactccgggcatggcgaagaat
acctatggtactggatgcttcctcctgtacaacgttggcgagaaaccggttatttcgaag
catggcctgctcggtactgtcggatttcaattaggaaagaaccggaagcccgtgtatgca
cttgaaggaagtgtggccgtcgctggtagtggtgtttcattcctcatgaacaatatgggc
tttttccgagactcacgtaaagtgagtgacttggcggcaatggttccagacaacggaggg
tgtgtcttcgtcacagccttcagtggtctctttgcgccatactggattgatgacgccaag
ggaacaatttttggaatcacgcaacatacccaacgtggtcacatcgcacgtgcgactatg
gaggccgcctgcttccaaaccaaagcgattctcgatgccatggagatggacagtgggcac
tccctctctcagctcgccgtcgacggaggaatgagcaactcggatatctgcatgcagacc
caagcagacatcattcaaattcccgtcgaacgaccggccatgcatgagacgacagcgctg
ggcgcagcaatcgccgccggcttcgccatcgatatctggaaggaatttgatgaacttaaa
aacatgaaccgcgccaaccgaacctcattcacccccgcaatctcccgcgaacaaagccag
aagatgtataaacagtggacgaaagccgtcgaaatgtctcgcggttgggtggataccaag
gagatgggaggtgaggacgactag

DBGET integrated database retrieval system