KEGG   Aspergillus nidulans: AN5626.2Help
Entry
AN5626.2          CDS       T01016                                 

Definition
ACSA_EMENI Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ani01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ani00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ani00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ani00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ani00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 670 aa AA seqDB search
MSDGPIAPPKPAVVAEAHEVDTFHVPKAFFDKHPSGPHLKNLDEYKKLYEESIRSPDVFW
ARKARELLTFDKDFQTTRIGSLENGDVAWFPEGRLNASFNCVDRHAIKNPNKVAIIYEAD
EPNEGRTITYGELLREVSRVAWVLKQRGVKKGDTVAIYLPMIPEAIIAFLACSRIGAVHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEGLKQCPDVSTVLVYKR
TGAEVPWTEGRDIWWHEEVEKYPAYIAPDSVNSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRYFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPDFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDHHIHHKMEHLRVLGSVGEPIAAEVWKWYFEKVG
KEEAHICDTYWQTETGSNVITPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEISGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHPMVAEAAVVGIADELTGQAVNAFVSLKEGNETNDQVRKDLIL
QVRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVERI
IATVHASRGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggaccaattgcccctcccaagcccgccgtggttgctgaggcccacgaggtc
gacactttccacgttcccaaggcgttcttcgacaagcacccttccggccctcacttgaaa
aatctcgatgaatacaagaagctctatgaggagtcgattcgcagcccagacgttttctgg
gcccgcaaagcccgtgagctgctcacttttgacaaagatttccaaacgacccgtatcggc
tcattggagaacggtgacgttgcttggttccctgagggtcggctaaatgcttctttcaac
tgtgtcgatcgtcacgccatcaagaaccccaacaaggtcgctatcatctacgaagccgac
gaacccaacgagggccggacaatcacatatggcgagctgctccgcgaagtttctcgggtt
gcctgggttttgaaacagcgcggcgttaagaagggcgacactgtggctatctaccttccc
atgattcctgaggccatcatcgccttccttgcgtgctcgcgtattggtgccgttcactcc
gttgttttcgccggtttctcgtcagactccctccgtgaccgtgtccttgacgccggttcc
aaggttgtcatcacaaccgatgagggtaagcgtggcggtaaggtcatcgggaccaagcgc
attgtcgatgagggtctcaagcagtgccccgacgtgtcgaccgtgcttgtttacaagcgc
accggcgccgaggtgccctggaccgagggccgtgacatttggtggcacgaggaggttgag
aagtaccctgcgtacattgctcctgactctgtcaactccgaggatcctcttttccttcta
tacacttctggttccaccggtaagcccaagggtgttatgcacactactgccggttacctc
ctaggcgcggctatgaccggaaaatacgtttttgatatccatgatgatgaccgctacttc
tgcggtggtgatgtcggctggattaccggccacacctacgtggtgtacgctcctctcctc
ctgggatgctcaacggttgtctttgagagtaccccggcttaccccgacttctctcgctac
tgggacgtgattgagaagcacaaggtgacccaattctatgtggcacccactgccctgcga
ttgttgaagagggctggtgaccaccacatccaccacaagatggaacatctacgtgtcctg
ggatccgtcggcgagcccattgctgctgaggtctggaagtggtacttcgagaaggttgga
aaggaagaggctcacatttgcgacacctactggcaaaccgaaactggctccaacgtcatt
acccccttggccggtgtcactcccacgaagcctggcagtgcttccctgcccttcttcggt
attgagcctgccatcattgatccagtctctggagaggagatctccggcaacgatgtggag
ggtgtgcttgccttcaagcagccctggcccagcatggcccgcactgtgtggggtgcccac
aagcgctacatggacacatatctgaacgtctacaagggttactacttcaccggagatgga
gccggtcgtgaccacgagggatactactggatccgtggtcgtgttgacgatgtcgtcaac
gtttctggtcaccgtctgtcaaccgcggaaattgaggctgccctcattgagcaccctatg
gttgctgaagcagccgtggttggtattgccgatgagttgaccggtcaggccgtcaatgcc
tttgtttcgctcaaagagggtaacgagaccaacgaccaagtccgcaaagacctcattctg
caagtccgcaagtcgattggacccttcgctgctcccaaagccgtctttgttgtcgacgac
ctgcccaagacccgtagcggtaagatcatgcgccgcatcctgcggaagattcttagtggt
gaggaggatagcctgggcgacatttcaacgctgtccgatccatccgtggttgagagaatt
atcgccacagtgcacgcttcccgaggcaaataa

DBGET integrated database retrieval system