KEGG   Aspergillus nidulans: AN5626.2Help
Entry
AN5626.2          CDS       T01016                                 

Definition
ACSA_EMENI Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AN5626.2
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN5626.2
   00620 Pyruvate metabolism
    AN5626.2
   00640 Propanoate metabolism
    AN5626.2
  Energy metabolism
   00680 Methane metabolism
    AN5626.2
Enzymes [BR:ani01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AN5626.2
Lipid biosynthesis proteins [BR:ani01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AN5626.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 670 aa AA seqDB search
MSDGPIAPPKPAVVAEAHEVDTFHVPKAFFDKHPSGPHLKNLDEYKKLYEESIRSPDVFW
ARKARELLTFDKDFQTTRIGSLENGDVAWFPEGRLNASFNCVDRHAIKNPNKVAIIYEAD
EPNEGRTITYGELLREVSRVAWVLKQRGVKKGDTVAIYLPMIPEAIIAFLACSRIGAVHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEGLKQCPDVSTVLVYKR
TGAEVPWTEGRDIWWHEEVEKYPAYIAPDSVNSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRYFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPDFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDHHIHHKMEHLRVLGSVGEPIAAEVWKWYFEKVG
KEEAHICDTYWQTETGSNVITPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEISGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHPMVAEAAVVGIADELTGQAVNAFVSLKEGNETNDQVRKDLIL
QVRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVERI
IATVHASRGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggaccaattgcccctcccaagcccgccgtggttgctgaggcccacgaggtc
gacactttccacgttcccaaggcgttcttcgacaagcacccttccggccctcacttgaaa
aatctcgatgaatacaagaagctctatgaggagtcgattcgcagcccagacgttttctgg
gcccgcaaagcccgtgagctgctcacttttgacaaagatttccaaacgacccgtatcggc
tcattggagaacggtgacgttgcttggttccctgagggtcggctaaatgcttctttcaac
tgtgtcgatcgtcacgccatcaagaaccccaacaaggtcgctatcatctacgaagccgac
gaacccaacgagggccggacaatcacatatggcgagctgctccgcgaagtttctcgggtt
gcctgggttttgaaacagcgcggcgttaagaagggcgacactgtggctatctaccttccc
atgattcctgaggccatcatcgccttccttgcgtgctcgcgtattggtgccgttcactcc
gttgttttcgccggtttctcgtcagactccctccgtgaccgtgtccttgacgccggttcc
aaggttgtcatcacaaccgatgagggtaagcgtggcggtaaggtcatcgggaccaagcgc
attgtcgatgagggtctcaagcagtgccccgacgtgtcgaccgtgcttgtttacaagcgc
accggcgccgaggtgccctggaccgagggccgtgacatttggtggcacgaggaggttgag
aagtaccctgcgtacattgctcctgactctgtcaactccgaggatcctcttttccttcta
tacacttctggttccaccggtaagcccaagggtgttatgcacactactgccggttacctc
ctaggcgcggctatgaccggaaaatacgtttttgatatccatgatgatgaccgctacttc
tgcggtggtgatgtcggctggattaccggccacacctacgtggtgtacgctcctctcctc
ctgggatgctcaacggttgtctttgagagtaccccggcttaccccgacttctctcgctac
tgggacgtgattgagaagcacaaggtgacccaattctatgtggcacccactgccctgcga
ttgttgaagagggctggtgaccaccacatccaccacaagatggaacatctacgtgtcctg
ggatccgtcggcgagcccattgctgctgaggtctggaagtggtacttcgagaaggttgga
aaggaagaggctcacatttgcgacacctactggcaaaccgaaactggctccaacgtcatt
acccccttggccggtgtcactcccacgaagcctggcagtgcttccctgcccttcttcggt
attgagcctgccatcattgatccagtctctggagaggagatctccggcaacgatgtggag
ggtgtgcttgccttcaagcagccctggcccagcatggcccgcactgtgtggggtgcccac
aagcgctacatggacacatatctgaacgtctacaagggttactacttcaccggagatgga
gccggtcgtgaccacgagggatactactggatccgtggtcgtgttgacgatgtcgtcaac
gtttctggtcaccgtctgtcaaccgcggaaattgaggctgccctcattgagcaccctatg
gttgctgaagcagccgtggttggtattgccgatgagttgaccggtcaggccgtcaatgcc
tttgtttcgctcaaagagggtaacgagaccaacgaccaagtccgcaaagacctcattctg
caagtccgcaagtcgattggacccttcgctgctcccaaagccgtctttgttgtcgacgac
ctgcccaagacccgtagcggtaagatcatgcgccgcatcctgcggaagattcttagtggt
gaggaggatagcctgggcgacatttcaacgctgtccgatccatccgtggttgagagaatt
atcgccacagtgcacgcttcccgaggcaaataa

DBGET integrated database retrieval system