KEGG   Aspergillus nidulans: AN5640.2Help
Entry
AN5640.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AN5640.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 1068 aa AA seqDB search
MPATVPTAADNSESRPTAEDFVDSDQDAEGEETDLYQMDQQLQDAVHRAYSGEIEAESGA
VEVDEDMDAEGEVDYDHVPNGEIDEAEPVGAVKIPEGASSINNDNDDDADADADADADDD
PEFNEQSESERGGSSSSSSRDSDEDWEAESNGPAEAEADNNTVRGNCIFCNQDEDHDPSE
EFEEYLSCAVCGDHSHRQCARENNALNDAEDTGSWRCPTCHSENLEPSSKEEASSRRKSG
PKNMNKELLPAHSGEEGSDFHSIFDTVTVDEELLNSSRSLRKRKTQSVDAEEHAPVLRKR
LRQSPARVARADSQDQIKANGDALSPVRTRSRRTRKDEQEHCRVVVKQFGKLVVAFRLPD
VKLSKILNSRSRSSIRNRKIPKPPPPQEPPQAHFAPITPISYFPSLYSFSDRELEESSKA
KPYGGILSEADADTSKTLPSQLDRERFEAARQKAEDAWQKRLAESQNGGETVQHASQKVS
GPPSRIKYINFGGFEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAK
HPPGDEIYREGSISIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEFDD
LGCHFVGYFSKEKRPSSANNVSCILTLPIHQRKGYGNLLIDFSYLLTRIEGKTGSPEKPL
SDMGLVSYRNYWRLVLSYQLRNQKTPVSIAELSERTGMTADDVVSGLEALRALVRDPVTR
TYALRLDYDYFEECIRGWESKGYVTLNPNALVWTPYIMGRNNQSQFDRAPIHTVAPREGL
EEDDDERKELVEEASKQLEASKRNSQALVNGISSAEVAGTLHEPAGPPSIDSLSNTNGVH
HQTSTGAAGQKESGPLSNVPAWRFEIYPPVQAPVSKKRSGRPFGAKSFQKTSITPTTTRT
SGRTTPRKAASLSTITPTANEHSVRRGRSAKLFDSPSIGTENVATNGIEPDQLDLAGETG
INSGQEAVRFTVGEQGTPDLSENPSDAQIPPTANGVNGSKAVEEQQGPVTPSKGKIVEGR
AKLTRSASRKSVVEKIEMLIPAEGEGVAVPDDHGSDVDAEGDIDMEET
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgccggcaactgtgccgacggccgccgacaattctgaatcgaggccaacggcggaggat
tttgtggacagtgaccaggatgccgaaggggaggagacagacttgtatcagatggatcag
cagctccaggatgctgtacaccgcgcgtattcgggggaaatcgaggccgagtcaggggct
gttgaggtcgacgaggatatggatgctgagggagaggtagattacgatcatgttccaaat
ggggagatcgatgaagcagagcccgtgggtgccgtcaagattccagaaggtgcttcatct
atcaacaatgacaatgacgatgacgcagatgcagatgcagatgcggatgcggatgacgat
ccagaattcaatgaacagagtgagagcgagcgcggcggatctagttcatcgagcagtcgc
gattcagatgaggactgggaggcggagagcaatgggcctgcggaagctgaagcggataat
aacacagttcgcgggaattgcatattttgcaatcaagatgaagatcatgacccaagcgaa
gagtttgaggagtacttgagctgtgctgtttgtggcgatcactctcatcggcaatgtgct
cgtgaaaataatgctttaaacgatgctgaagatactggctcctggagatgtccaacctgt
cacagcgagaacttggagcctagttctaaagaggaggcctcatcgcgacgaaaaagcggc
ccgaagaacatgaacaaggagcttctgccagctcacagtggcgaagaaggttcagatttc
cattctatcttcgataccgtgaccgtcgatgaagagctactaaacagctcacggtcgctt
cggaagagaaaaacccagtctgtcgacgcagaggaacacgcacctgttctccgcaagcga
ctgaggcaatcgcctgcgcgagtcgcacgagccgactcgcaggatcaaattaaagccaac
ggagacgctttgtcgcccgtccgcacccgttctcggcgcactagaaaagatgagcaggaa
cattgccgtgtagtagtgaaacagtttggcaaactcgtcgtggcttttcggttacctgac
gtgaaactttctaagattctcaattcgcgcagtcggtcctcaattcgaaaccgaaagatc
cccaaaccacctccaccacaagaaccaccacaggcccattttgccccaatcactcccatt
tcttatttcccgtctttatattccttcagtgaccgcgagctagaggagtcctcgaaagcc
aagccctacggagggattctctccgaggcagatgctgacacctccaagacgctaccttca
caacttgaccgtgaacgcttcgaagccgcacggcagaaagctgaagacgcttggcaaaaa
cgtctagcagagtcccagaatggtggcgaaactgtgcagcatgcttctcagaaggtctct
gggcctccatctaggatcaagtatatcaactttggcggattcgagattgagacttggtac
gcagcgccgtatcctgaggagtatagtcgaaaccgagtactctacatatgcgaattttgc
ttgaagtatatgaattcggactatgtcgcgtggcgccataaactcaaatgccccgcaaaa
catcctcccggcgatgagatctaccgtgaaggctccatctcaatcttcgaggttgatggg
cggaaaaatccagtctattgtcagaatttgtgcttgcttgcgaaactgttcctggggtct
aaaacgctttactatgacgtcgaacccttccttttctatgtcatgaccgagtttgacgat
ttagggtgtcacttcgtggggtatttcagcaaagagaaacggccaagctcagcgaacaac
gtctcgtgcattcttactctacccatacaccagcgaaagggttatggaaatctcctcatt
gacttctcttacctccttactcgcatcgaaggcaaaacgggctcgcctgaaaagcctctt
tccgatatgggcttggtttcctatcgaaattattggcggcttgtcttgtcataccagctg
cgaaatcaaaagacgccggtcagcattgccgagctttccgaacgcacaggtatgacggca
gatgatgtcgtttctgggctggaagcattacgcgctttagtacgagatcccgtgaccaga
acatacgctctccgtctcgattacgactattttgaggaatgtattcgcggctgggaaagc
aagggatatgtgacgctaaacccaaatgcacttgtttggaccccgtacatcatgggtagg
aataatcagtcacaattcgaccgcgctcctatacataccgtcgcgccacgcgaggggctt
gaagaagacgatgatgaaagaaaagagctagttgaagaagcttcaaagcagttggaggcc
tccaagcggaacagtcaagcgctggttaacggcataagtagcgcggaagtcgccggtaca
ctgcatgaacctgcaggtcctccttctatagattccctgtctaacaccaatggcgtccat
catcaaacatcaacaggcgcggccggacaaaaggagtcgggacctttgagcaatgttccg
gcatggcggttcgaaatataccccccagttcaagcaccagtctccaaaaagcgttctggc
cgcccgtttggggcgaagtcatttcaaaaaacctctatcactccgactactactcgcacc
agcggtcgtactacgccccgaaaggccgcctccctttcaacaataaccccaacagcaaac
gaacatagtgttagacgaggtcggagtgcgaagctatttgactccccttcgatcggaacg
gaaaacgtggcaacgaacggtatagagccagatcagctcgatctcgctggtgaaacagga
atcaacagcggccaggaggctgtccgttttacggttggagaacaagggaccccagatcta
tctgaaaatccgagtgatgcccaaataccgcccacggccaatggcgttaatggatcaaaa
gcggtcgaagagcagcaagggccagtgacaccttcgaaagggaagattgtcgaaggcaga
gccaaactcacgcggtccgctagtcgaaaatctgttgtggagaaaatcgaaatgcttata
ccagcggagggtgaaggcgtcgctgtgcctgacgatcatggaagcgatgtcgatgcggag
ggcgatatcgatatggaggagacataa

DBGET integrated database retrieval system