KEGG   Aspergillus nidulans: AN5666.2Help
Entry
AN5666.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ani  Aspergillus nidulans
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AN5666.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AN5666.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   AN5666.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 240 aa AA seqDB search
MRTENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVD
QLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKVPFQRLFPNANPDALDLLDRMLA
FDPSSRISVEEALEHPYLAIWHDASDEPSCPTTFDFHFEVVDDVQEMRRMIYEEVVRFRQ
SVRMPPQAQSLAQQQQIGNIPIPEHQQGVWRQEEPRPQEAGAVGGNHNDLESSLQRGMDA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcggactgagaacgccggttacatgactgaatatgttgcgacaagatggtatcgcgct
ccggaaatcatgttgagtttccagagctacacaaaagctatcgatgtgtggtccgtaggt
tgcattctggcggagttgttaggtggccgccccttcttcaagggtcgcgactatgtcgac
cagctcaaccagatcttgcactacctgggcactccgaacgaagaaactctgagccgcatt
ggctcaccacgtgcccaggagtatgtgcgtaacttgccctttatgcccaaggtgcccttc
cagcgcctgttcccgaacgccaatcccgatgctctcgatctactcgaccgcatgcttgct
ttcgacccttcgtcacgtatctcggtggaagaggctctggaacacccttaccttgcaatt
tggcacgacgcatccgatgagcctagctgccccaccacctttgacttccactttgaggtg
gttgacgatgtgcaggagatgcgccgcatgatctacgaggaagtcgtccgttttcgccaa
tcggtgcgcatgcccccgcaggcgcaatctctcgcccaacaacagcaaataggcaacatc
cccattcccgagcatcagcagggagtgtggaggcaagaagagcctaggcctcaagaagca
ggcgccgtaggcggcaaccacaacgatctggaatcgtccttgcagcgggggatggatgcg
taa

DBGET integrated database retrieval system