KEGG   Aspergillus nidulans: AN5745.2Help
Entry
AN5745.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ani  Aspergillus nidulans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ani03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 284 aa AA seqDB search
MPPSKWDEEEEEGVSPPPVAARRRFDDEEDGDVLDSWDAADDSEVEREKAAKAAEAKAKA
EAEAAANKKSKAQRIAEHKTRRKAAEDEEDDESDEDEAEKRARLRRTEKDSDLKHAEDLF
GDIDLNRNRGKNKTIVVHDASGDPTQAVDLSAMPLFKPATKEQFTTLSNTLVPLLTAQSK
KPQYALWLPEFAKQLAKELPSGDIKKVASALTTLSNEKMKEERAADKGSKKTKAAKTKVS
LVASRSDKIETTAYDDDDIEAMASDCMENNKEEKGKGSTVEGDK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgccgccatccaagtgggatgaagaagaggaagagggagtttcccctccacccgttgct
gctcgccgtcggtttgatgatgaagaggatggagatgtccttgactcctgggacgccgcc
gacgacagcgaagtagagcgtgagaaggccgcgaaggctgccgaagccaaagccaaagct
gaagctgaagctgccgccaacaagaagagcaaagcacagcggatagcagagcacaaaaca
cgccgcaaagccgccgaggacgaagaggacgacgagagtgacgaggacgaggccgagaag
cgcgcccgcttgcgccgcacggaaaaggactccgacctaaagcacgcggaggatctcttt
ggcgacattgaccttaaccgcaaccggggcaagaacaagacaattgttgtgcatgacgcc
tcgggcgacccgacgcaggctgtagatctttccgcgatgcccctgttcaagccggcgacc
aaggagcaatttaccacgttgtcgaacacgcttgtaccgcttttgaccgcgcagagcaag
aagccgcagtatgcactctggctgccggagttcgccaagcagctggccaaggaattgcct
agtggagatattaagaaggtggctagtgcgttgacgacgctgagcaatgagaagatgaag
gaggagagggcagctgataagggaagcaagaagactaaggcggctaagacaaaggtgtcg
ctagttgcgtcgaggagtgacaaaattgagacgaccgcttatgatgatgatgatattgaa
gctatggcctctgattgtatggaaaacaacaaggaggaaaagggcaaggggtcaacggtg
gaaggcgataagtga

DBGET integrated database retrieval system