KEGG   Aspergillus nidulans: AN5745.2Help
Entry
AN5745.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ani  Aspergillus nidulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AN5745.2
Translation factors [BR:ani03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AN5745.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 284 aa AA seqDB search
MPPSKWDEEEEEGVSPPPVAARRRFDDEEDGDVLDSWDAADDSEVEREKAAKAAEAKAKA
EAEAAANKKSKAQRIAEHKTRRKAAEDEEDDESDEDEAEKRARLRRTEKDSDLKHAEDLF
GDIDLNRNRGKNKTIVVHDASGDPTQAVDLSAMPLFKPATKEQFTTLSNTLVPLLTAQSK
KPQYALWLPEFAKQLAKELPSGDIKKVASALTTLSNEKMKEERAADKGSKKTKAAKTKVS
LVASRSDKIETTAYDDDDIEAMASDCMENNKEEKGKGSTVEGDK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgccgccatccaagtgggatgaagaagaggaagagggagtttcccctccacccgttgct
gctcgccgtcggtttgatgatgaagaggatggagatgtccttgactcctgggacgccgcc
gacgacagcgaagtagagcgtgagaaggccgcgaaggctgccgaagccaaagccaaagct
gaagctgaagctgccgccaacaagaagagcaaagcacagcggatagcagagcacaaaaca
cgccgcaaagccgccgaggacgaagaggacgacgagagtgacgaggacgaggccgagaag
cgcgcccgcttgcgccgcacggaaaaggactccgacctaaagcacgcggaggatctcttt
ggcgacattgaccttaaccgcaaccggggcaagaacaagacaattgttgtgcatgacgcc
tcgggcgacccgacgcaggctgtagatctttccgcgatgcccctgttcaagccggcgacc
aaggagcaatttaccacgttgtcgaacacgcttgtaccgcttttgaccgcgcagagcaag
aagccgcagtatgcactctggctgccggagttcgccaagcagctggccaaggaattgcct
agtggagatattaagaaggtggctagtgcgttgacgacgctgagcaatgagaagatgaag
gaggagagggcagctgataagggaagcaagaagactaaggcggctaagacaaaggtgtcg
ctagttgcgtcgaggagtgacaaaattgagacgaccgcttatgatgatgatgatattgaa
gctatggcctctgattgtatggaaaacaacaaggaggaaaagggcaaggggtcaacggtg
gaaggcgataagtga

DBGET integrated database retrieval system