KEGG   Aspergillus nidulans: AN5795.2Help
Entry
AN5795.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ani  Aspergillus nidulans
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AN5795.2
Enzymes [BR:ani01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AN5795.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 1220 aa AA seqDB search
MSRSSAGFADFFPTAPSVIQQKRYQATRERQRSRPHLSREHADEEQIVTGSRTSGETVNG
NSPQNLGQELRSDLNKSRKEVAEDGSASHGEANTPANNTSGPGTGSSNDTRLDTLTPLTN
TESSPQNNPSPSQAKAPNGDEPDGFRQARANVSNSTMTPLHTPPTPTTHSLSQRVAIVKG
SKLVHDPDRAPSKDKRKRPCYVDIVSDEQEGRLSDPRLSIQNYTRGAGCRQKTKYRPAPY
VLRHWPYDPASTVGPGPPVQIVVTGFDPLTPLAPISTLFSSFGEIAEINNRTDPDTGRFL
GICSVKYKDSASFHGSGPVSASLAAKNAFHECKKGQRIGNNRIKVEYDRDGQTSEKLASR
AIAAQRIDSKIDMPVVGEPKSEAQVNKNEPPPTAPKGPSGRSFMRPSAVIPEGPRASFQK
PAIPSLIEETPILNQIKRDPYIFIAHCYVPVLSSTLPHLKKRLKAFNWKDIRCDRTGYYI
IFENSRRGEEETERCYKFCHMKLLFTYIMNMESQPYGNPHYERSPSPERMKQEQRQKAET
ERLKKEAELDIEEEKKQRALDLDPCTEVLAIVIKDLRDKLLEDVKSRIAAPALYDYLDPE
RHASRRKQLGIPDPEGIKRPMFRLDFDSRDSTPDPHAKFLNKRHPSGVSGLNILSALPRI
RKAHRLDRTDVAFLDERRKQPLRRRNVRPLYHRLQQLHDAEDSDEEQHTPLSRDTDDQDS
RPPSRIGSETESEDADEDAAEALDNSTERLDNEDRHSEIGDLEAAVQDYSPSRKRKRTSE
SPSHRKKQKESDDFSAVGEGTRTDDIPQVLDGVHKGTVSQGLSDSADESSRLDHNKVLLE
ELVEDIKTTHSEEPGIKTHHVQVRQSAENMVEGAEYGEAARHEVEWRVSNDEPRPIVDDD
DSVVMDLDGWQDVVKDEEDLQFLRNILEKQPMSVIGNLSAWAWRQKEIKALNRPGDVGPT
RQAASIEGYYVPNITGAARTEGRKRILESEKSKYLPHRIKVQKAREEREAKAKSDPQNAA
AEAARIAAAKTISKSTSRSTRVNNRRLIADINAQKQALPSQGGDSDVLRFNQLKKRKKPV
RFARSAIHNWGLYAEVNISANEMIIEYVGEKVRQQVADMRERRYLKSGIGSSYLFRIDEN
TVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIERDEELTYDYKFEREW
DSDDRIPCLCGSAGCKGFLN
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgctcttccgcaggcttcgcagacttctttcccaccgccccatcggtcatccag
cagaaacgatatcaagccactcgagaacgacagcggtcgagacctcatctcagcagggag
catgccgacgaggaacagattgtcaccggatcccggacctctggggaaactgtcaacggc
aatagccctcagaatcttggacaagaactccggtcagacctgaacaagtcgcgcaaggaa
gtcgcggaagacggttccgcgagccatggagaggcgaacactccggcgaacaacacatcg
ggacccggaacaggttcatcgaatgatacccgcctggatactcttacgccgctcacaaac
acggagtcatccccgcagaacaatccgagcccgtctcaagcgaaggcgccgaacggagat
gaacctgatgggtttagacaagcaagagcaaatgtctcaaacagcaccatgacaccgctt
catacgccgccaacaccaacaacgcattcactgagtcagcgtgttgcaatcgtcaagggc
agcaagttggtacatgaccctgatagagccccgtccaaggataaacgaaagaggccttgc
tacgtggatattgttagtgatgaacaagaaggacgtttgtccgaccctcgattgagcata
caaaattatactcgcggtgctggatgccgacagaagacgaagtaccgacccgctccgtac
gtcctaaggcactggccctacgaccctgccagcacggtaggaccggggcctcccgtgcaa
attgttgttaccggtttcgacccattgacgcctctcgcaccgataagtacgctcttttcg
agttttggcgagatagcagagatcaataaccgaacggatcccgacacgggcagattcctg
ggcatatgctccgtcaaatataaggacagcgcatcgtttcacggtagcggtcctgtttcc
gcgtcgttggcagcgaagaatgcatttcatgaatgcaaaaaggggcagcgtattggcaac
aatcgcatcaaggttgagtatgatcgcgatgggcagacttcggaaaaactagcttcgagg
gctattgcagctcaaagaattgattcgaagattgatatgcccgtggtgggtgagcctaaa
tcagaggcacaggtgaacaaaaatgaaccacccccgacagctccaaaagggccctctgga
agatccttcatgcgcccttcggctgtcatccctgaaggacctagggcaagctttcagaaa
ccggcaataccatcattgattgaagaaactcccatactaaaccagataaagcgtgatccc
tatatcttcatcgcacattgttatgtacctgttctaagctcgactctgccgcacttaaaa
aagcgattaaaggcgttcaactggaaagatattcgatgcgacagaaccggatactatatc
atatttgagaactctcggcgcggtgaagaggaaactgaacgctgttacaagttctgccat
atgaaacttttattcacgtatatcatgaatatggaaagccaaccgtacggcaatccgcat
tacgagcgcagccccagtcccgagcgcatgaagcaagaacaacggcaaaaagcggaaact
gaacgattgaagaaagaggcagagttggacattgaagaagaaaagaaacagcgagccctg
gatttggatccctgcactgaagttttggcgatcgtaataaaggatctaagggacaaactg
ctcgaagacgttaagtcacgcattgctgcccccgctctgtatgattatctcgacccagaa
cggcatgcatcaaggaggaaacaactggggatacctgatcctgaaggcattaaacgtcct
atgttccgccttgattttgacagccgtgatagtacacccgacccacatgcaaaattcttg
aataaacggcacccttcaggcgtatctggtctgaatatactctctgcccttccaaggatt
aggaaagctcatcgcctcgaccgtacggacgtcgctttcttagacgagaggcgcaagcaa
ccgctacggagaagaaatgtccgaccactttaccatcgattacagcagctacatgatgca
gaagactctgatgaagagcagcatactccactttcccgagacaccgatgatcaggacagt
cgtcctcccagtcgaattggctcagaaaccgaatctgaggatgcggatgaagatgcagcc
gaagcattggataattcaacagaaaggctcgataatgaagaccgacattccgagataggc
gacttggaggctgcagtacaagactactctccgtcgcggaagaggaaaagaaccagtgaa
agtcccagccaccgcaagaaacaaaaggaatctgatgatttctctgctgtgggcgaggga
actcggacggatgacattcctcaggttttggatggagttcacaagggcaccgtttctcag
ggattatctgactcggctgacgagtcatcacgccttgaccacaacaaggtattgcttgaa
gaactagttgaagacataaaaaccacgcactcagaagagcctggcatcaaaacccatcat
gttcaagttagacaatcagcggaaaatatggtcgagggggccgaatatggcgaggcggcc
cggcacgaggttgaatggagagtatcaaatgatgagccacggccgattgtggacgatgat
gattctgttgtcatggatcttgacggatggcaagacgtcgtgaaggacgaggaagattta
cagttccttcgcaatatcctggaaaagcagccgatgtctgtgattggaaacctatcagct
tgggcatggagacagaaggaaatcaaggctctcaatcgccccggcgatgtagggccaacg
cgccaggctgcaagcatcgaaggttattatgttcctaatattacaggagctgctcgaacc
gaaggcagaaagaggattctcgaatcggaaaaatcaaaatatctaccccatcgcattaag
gtccagaaggctcgcgaggaacgcgaggcgaaggccaagagcgatccacagaatgcagct
gccgaggcggctcgaatcgcagcagcaaagacaatatcaaagtcaacatctcgttcgaca
agggtgaataaccgcagactgattgctgacatcaatgctcaaaagcaagctctaccatcg
cagggtggcgatagcgatgttcttcgatttaaccaattgaaaaaacggaaaaagcctgtg
cgttttgcacgatcagctattcataattgggggctctatgctgaagtcaatatatctgca
aacgaaatgatcatcgaatatgtgggggagaaggtacggcagcaggttgccgatatgagg
gagcgacgatacctaaagagcggcattggcagtagctatctctttcgaattgatgagaac
acagtcattgatgccacaaagagaggcggtattgctagatttatcaaccacagctgcaca
ccaaactgcacagcgaagatcatcaaggttgatggaagcaaacgaatagttatttatgca
ttgagggatatcgaaagggatgaagaattaacttacgactacaaattcgagagggaatgg
gacagcgatgacagaataccatgcctttgcggctcggccggatgtaaaggctttctgaat
tag

DBGET integrated database retrieval system