KEGG   Aspergillus nidulans: AN5817.2Help
Entry
AN5817.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ani  Aspergillus nidulans
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AN5817.2
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AN5817.2
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AN5817.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AN5817.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 340 aa AA seqDB search
MSFLSLLALLAWGCGEWTCELPRYLAHFSDDGKRTQYLNAQNTFAQLFDMGVIPIVNEND
TLAVSEIKFGDNDTLSAITAAMVKADYLFLMTDVDCLYTANPRTNPDAQPIEVVSDISSL
EADVSSAGSALGTGGMSTKITAAKLGTSAGVTTIITKSSKPGNIHEIVRYLQHSRQAALA
DAADVEITASKPQTPIPPLHTRFLPSETPIQSRTFWLLHGLKPHGTLYIDQGAYTALQKK
ASLLPAGVVDVDGHFGQQEAVRIVVVERISPESLNGDFLHPGQEPKEVGRALVNYGSLEI
ARIKGHRSTHIQSLLGYADSEYVALRENISFFDNDEQVRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcttgtctcttctggcgctgttggcgtggggttgcggagaatggacgtgtgaa
ctgcctcgatatttggcccacttttctgatgatggcaagcgcactcaataccttaacgcg
caaaacactttcgcccaattatttgacatgggcgtaatcccaattgtcaacgaaaatgat
acattggcagtctcggaaatcaaatttggtgacaatgatacattatcagccatcacagcc
gcgatggtcaaggctgattacctctttctgatgaccgatgtcgactgtctttatacagca
aatccacgaaccaatcctgacgcacagccgatcgaggtagtttcagacatttcgtcactg
gaagcggacgtttcatctgctggctctgcccttggaacagggggtatgagcacgaaaatc
acagccgcgaaattggggacgagcgctggtgtgacaacaataattaccaagagctcaaaa
cccgggaacatccatgagatcgtgagatacctccagcattcaaggcaagcggctcttgcc
gatgctgcagatgtagagattaccgcatcgaaaccgcagacgccaatcccacctctgcat
actcggtttcttccgtccgaaacccccattcagtcgcgtacattctggctgctccacgga
ttgaagcctcatggtactctgtatattgatcaaggcgcatacactgcacttcagaagaaa
gcgagccttcttccggcaggtgttgttgacgtagacggccacttcgggcagcaagaagca
gtccggatagttgttgtggagagaatatctcccgaatctctcaatggcgattttcttcat
ccaggccaagagccaaaagaggtgggacgtgccttggtaaactatggcagcctcgagata
gcccggatcaagggtcaccgaagcacccatatccagtcattactagggtatgcggatagt
gaatacgttgcgctgcgagaaaacatctcttttttcgataatgacgaacaagtacgacga
tag

DBGET integrated database retrieval system