KEGG   Aspergillus nidulans: AN5908.2Help
Entry
AN5908.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AN5908.2
   01230 Biosynthesis of amino acids
    AN5908.2
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN5908.2
   00051 Fructose and mannose metabolism
    AN5908.2
   00562 Inositol phosphate metabolism
    AN5908.2
Enzymes [BR:ani01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AN5908.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AN5908.2
  Exosomal proteins of bladder cancer cells
   AN5908.2
  Exosomal proteins of melanoma cells
   AN5908.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 284 aa AA seqDB search
MATSTKQTYPVLPKNLLLISLKMYFEPSRTLEYCRALLDPKNDIVRPENRSKLLLALIPD
FLTIYPCAEIIKEYVSTLPKDDSPSLPAPFLLGAQDCFWEPLGAYTGEVSPLSLSSLGVS
IVELAHAERRSIFGETDEQAARKAAAACAQGMVPLVCIGEISAPGPVASAAVGLAVRECE
PLVRAILNAIPADAPIIFAYEPVWAIGKPKPASVDHISAVVDGLRALIGRRSGDVRILYG
GSAGPGLWGPGGLGKAVDGMFLGRFAHDIEGVRKVVREVEESLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagcacgaagcagacctacccggtcctgcccaaaaatctactgctcatttcc
ttgaagatgtatttcgagccgtcccgtactctggaatactgccgtgcgctacttgatcca
aaaaatgacattgtccgcccggagaaccgatccaagctccttctcgcgctaatcccggac
tttcttacgatttatccctgcgcagaaatcatcaaagagtatgtctcgacgctaccaaag
gacgattctccttcgcttcccgccccattcctgctcggtgcacaagactgcttttgggaa
ccgctgggtgcctacactggcgaagtctcaccactgtctcttagctccttgggtgtctcc
atcgttgagttagctcatgcggagcgtcgctccatcttcggtgaaacagacgaacaggca
gcacgcaaggccgccgcagcctgcgctcaaggaatggtgcctttagtgtgcattggagaa
atcagcgcccctggtccagtggcttcggcagcagttggacttgcagtacgggaatgcgaa
ccacttgttcgagcgatattgaatgccattccggccgatgcacctatcatattcgcctac
gaacctgtctgggccattggaaagcctaagcccgcaagtgtggaccacatctctgctgtt
gtggatggtcttcgcgctttaatcggccggagatcgggagacgttcgcattctgtatgga
ggcagtgctggccccggtctgtggggccctgggggtctggggaaagccgtcgacggcatg
ttcctaggccgattcgcacacgatattgagggcgtgcgtaaagtcgtccgcgaagtcgag
gaatctcttacttga

DBGET integrated database retrieval system