KEGG   Aspergillus nidulans: AN5908.2Help
Entry
AN5908.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00010  Glycolysis / Gluconeogenesis
ani00051  Fructose and mannose metabolism
ani00562  Inositol phosphate metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
ani01230  Biosynthesis of amino acids
Module
ani_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ani_M00002  Glycolysis, core module involving three-carbon compounds
ani_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN5908.2
   00051 Fructose and mannose metabolism
    AN5908.2
   00562 Inositol phosphate metabolism
    AN5908.2
Enzymes [BR:ani01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AN5908.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AN5908.2
  Exosomal proteins of bladder cancer cells
   AN5908.2
  Exosomal proteins of melanoma cells
   AN5908.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 2870898
NCBI-ProteinID: XP_663512
UniProt: Q5B0M2 A0A1U8QKH8
Position
I
AA seq 284 aa AA seqDB search
MATSTKQTYPVLPKNLLLISLKMYFEPSRTLEYCRALLDPKNDIVRPENRSKLLLALIPD
FLTIYPCAEIIKEYVSTLPKDDSPSLPAPFLLGAQDCFWEPLGAYTGEVSPLSLSSLGVS
IVELAHAERRSIFGETDEQAARKAAAACAQGMVPLVCIGEISAPGPVASAAVGLAVRECE
PLVRAILNAIPADAPIIFAYEPVWAIGKPKPASVDHISAVVDGLRALIGRRSGDVRILYG
GSAGPGLWGPGGLGKAVDGMFLGRFAHDIEGVRKVVREVEESLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagcacgaagcagacctacccggtcctgcccaaaaatctactgctcatttcc
ttgaagatgtatttcgagccgtcccgtactctggaatactgccgtgcgctacttgatcca
aaaaatgacattgtccgcccggagaaccgatccaagctccttctcgcgctaatcccggac
tttcttacgatttatccctgcgcagaaatcatcaaagagtatgtctcgacgctaccaaag
gacgattctccttcgcttcccgccccattcctgctcggtgcacaagactgcttttgggaa
ccgctgggtgcctacactggcgaagtctcaccactgtctcttagctccttgggtgtctcc
atcgttgagttagctcatgcggagcgtcgctccatcttcggtgaaacagacgaacaggca
gcacgcaaggccgccgcagcctgcgctcaaggaatggtgcctttagtgtgcattggagaa
atcagcgcccctggtccagtggcttcggcagcagttggacttgcagtacgggaatgcgaa
ccacttgttcgagcgatattgaatgccattccggccgatgcacctatcatattcgcctac
gaacctgtctgggccattggaaagcctaagcccgcaagtgtggaccacatctctgctgtt
gtggatggtcttcgcgctttaatcggccggagatcgggagacgttcgcattctgtatgga
ggcagtgctggccccggtctgtggggccctgggggtctggggaaagccgtcgacggcatg
ttcctaggccgattcgcacacgatattgagggcgtgcgtaaagtcgtccgcgaagtcgag
gaatctcttacttga

DBGET integrated database retrieval system