KEGG   Aspergillus nidulans: AN5916.2Help
Entry
AN5916.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AN5916.2
   01212 Fatty acid metabolism
    AN5916.2
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AN5916.2
   00650 Butanoate metabolism
    AN5916.2
  Lipid metabolism
   00062 Fatty acid elongation
    AN5916.2
   00071 Fatty acid degradation
    AN5916.2
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AN5916.2
   00310 Lysine degradation
    AN5916.2
   00380 Tryptophan metabolism
    AN5916.2
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AN5916.2
Enzymes [BR:ani01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AN5916.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 314 aa AA seqDB search
MFARQSTRFLFPRTTTVITRVRLYSSAAPSYEHILTSTPKPGVGLNTDFTVIVTLNRPKA
LNALSSPLFKEVNDALSKYDESKDIGAIIITGSEKAFAAGADIKEMAPLTFASAYSNNFI
APWSHLANSIRKPVIAAVSGFALGGGCELALMCDIIYCTASATFGQPEIKLGVIPGAGGS
QRLTAAVGKSKAMELILTGKNFSGKEAGEWGVAAKVVDGGKEELLEEAVKTAETIAGYSR
VATVAAKEVVNKSQDLGVREGVEYERRLFHGLFGSQDQKIGRFLSLYHYSKNGTDGEKGM
TAFAEKKKPQWSHE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcccgtcaatccacccggttcctcttcccccgaaccacaacagttattacccgc
gtgcgcttgtactcatccgcggcaccgagctatgagcacatcctcacctcgaccccaaag
cctggagtcggcttgaatactgatttcacggtgatagtcactctcaaccgtcctaaagcc
ctcaacgccctctccagccctctcttcaaagaagtgaacgatgctctctccaaatacgat
gaaagcaaggatattggcgctatcatcatcacaggaagtgagaaggcttttgccgccggc
gcggacatcaaagaaatggcccctctaaccttcgcttccgcgtatagcaacaacttcata
gccccttggtcgcatctcgcgaattctattcgcaagcctgtaattgccgccgtttctggc
ttcgcccttggcggtgggtgtgaacttgctctaatgtgtgacatcatctactgcaccgcg
tccgccacgttcggacagcctgagatcaagctgggcgttatccccggcgccggcgggtcg
caacgtctcacggctgcggtgggcaagagtaaagcgatggaactcatcttaacgggcaag
aacttcagcggcaaagaggcgggtgagtggggagttgcggcgaaggttgtcgatggtggg
aaggaggaactcttggaggaggcagtgaagactgccgagacaattgccggatatagccgg
gttgcgactgttgcggcgaaggaagtagtgaataagagtcaggatttgggagtgagggag
ggcgttgagtacgagcggaggctgttccatgggttgttcgggagtcaggatcagaagatc
ggtaggtttttgtccctttaccattactccaagaatggcactgacggagagaaaggaatg
actgcgtttgcggaaaagaagaagcctcagtggtcgcacgagtaa

DBGET integrated database retrieval system