KEGG   Aspergillus nidulans: AN5982.2Help
Entry
AN5982.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ani  Aspergillus nidulans
Brite
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   AN5982.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 2371 aa AA seqDB search
MAQAGPITDVTQRLFIELKSKNEETRVRAAYELYENVLAISRDWPPEKFIEFYNAVSQRI
AQLVVTGSDAHERIGGLLALDRLIDFDGVDNAQKTTRFASYLRSALRSSDNAVLVYAARA
LGRLAKPGGALTAELVESEIQSALEWLQSERQEGRRFAAVLVIRELAKGSPTLLYGFVPQ
IFELIWVALRDPKVLIRETAAEAVRQLWFARIYEEALQGLKSNNVDWIHGSLLVLKELLL
KGAMFMNEHYRNACEIVLRLKDHRDPKIRTQVVLTIPILASYAPVDFTETYLHRFMVYLQ
AQLKKDKERNAAFIAIGKIANAVGVAIAQYLDGIIVYIREGLALKAKNRAAINEAPMFEC
ISMLSLAVGQALSKYMESLLDPIFACGLSESLTQALVDMAHYIPPIKPTIQVKLLDMLSL
ILDGTPFRPLGCPESRLPPLPSFAKDFTLQELHSDAEIALALHTLGSFDFSGHILNEFVR
DVAIHYVENDNPEIRKAAALTCCQLFVHDPIINQTSSHSIQVVSEVIDKLLTVGVGDPDP
EIRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFAVREAAICIIGRLSSVNPAYVFPP
LRKLLVNLLTGLGFASTARQKEESAQLISLFVSNATKLIRSYVDPMVTTLLPKAVDANHG
VASTTLKAVGELASVGGSDMKAYLPKLMPIVLDALQDLSSHAKREAALRTLGQIASNSGY
VIDPYTDHPHLLAVLIGIIKTEQAGSLRKETIKVLGILGALDPYKYQQISETAPDVHHIN
EVQVVSDVSLIMQGLAPSNEEYYPTVVIHTLMQNILRENSLAQYHSAVIDAIVTIFKTLG
LKCVPFLGQIIPGFISVIRGSPSSRLESYFNQMAILVNIVRQHIRAFLPEIIEVIREFWD
TSYQVQATILSLVDAIAKSLEGEFKKYLANLIPPMLDTLEKDNTPRRQPSERILHSFLVF
GSSGEEYMHLIVPSIVRLFDRSQNPASIRKSAIDSLTKLSRQVNVSDFASLIVHSLSRVV
AGNDRMLRQAAMDCICSLIFQLGQDFNHYIHLLNKVLKHHQVNHVNYQILVTKLQKGDPL
PQDLNPDESYAPLADDANYAEIGQKKMVVNQQHLKNAWDASQKSTREDWQEWIRRFSVEL
LKESPSPALRACASLAGIYQPLARDLFNAAFVSCWTELYDQYQEELVRSIEKALTSPNIP
PEILQILLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKELEFEQDQNSGAVEA
LITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAAYKRREKIDPDSFGI
TMGKMRCLHALGEWKVLSDLAQEKWNQASLEHRKSIAPLAAAAAWGRGQWELMDSYLGVM
KEQSPDRSFFGAILAIHRNQFDEAIMYIEKARNGLDTELSALLGESYNRAYNVVVRVQML
AELEEIITYKQNVGDPERQEAMRQTWNRRLLGCQQNVEVWQRMLKVRALVTTPRENLDMW
IKFANLCRKSNRMGLAERSLASLETVIPDGNGGTRTISPPEVTYARLKFSWATGRQREAL
HMLREFTANLTEDFTRFNALVASQSDHNGINGVNGIAEGNHTDIMALRERVGDVNKFRKL
LAKSYLRLGEWQTALQRGDWRPEHVREVLNAYSAATRYNRDSYKAWHSWALANFEVVTTI
ASQASKDGGNLALVPGHIVTEHVIPAIRGFFRSIALSSTSSLQDTLRLLTLWFNHGGDQE
VNSVVTEGFTAVNIDTWLAVTPQLIARINQPNFRVRSAVHRLLAEVGKAHPQALVYPLTV
AMKSNVARRSQSAGNIMESMRTHSANLVEQADLVSHELIRVAVLWHELWHEGLEEASRLY
FGDHNVDGMFATLAPLHEMLDKGAETLREVSFAQAFGRDLAEAKHYCMLYRETEEIGDLN
QAWDLYYTVFRKISRQLPQLSTLDLKYVSPKLKDCVDLDLAVPGTYQSGRPIIRIISFDP
ILHVLQTKKRPRRMTLKGSDGSSYMYVVKGHEDIRQDERVMQLFGLVNTLLDNDSESFKR
HLTVQRFPAIPLSQNSGIIGWVTNSDTLHALIKEYRETRRILLNIEHRIMLQMAPDYDNL
TLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLGVMSMVGYILGLGD
RHPSNLLLDRVTGKVVHIDFGDCFEVAMHREKYPERVPFRLTRMLTFAMEVSNIEGSYRI
TCEAVMRVIRENKDSLMAVLEAFIHDPLINWRLGIRESPDRMPFNAERRQSIVSNVNLEH
GVQPSNFSRHRRPSILEGGILDAQEGVPNEAREAQNARALQVLARVREKLTGRDFKPSEE
LNVSDQVDKLLAQATSVENICQHWIGWCSFW
NT seq 7116 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagcaggtccgatcacggacgtcacccagaggctcttcatcgagctgaagtct
aagaacgaggaaacgcgggtccgagctgcttacgagctttacgaaaatgttcttgccatc
tcaagagactggcctcccgagaagttcattgaattctataacgccgttagtcaacgcatc
gcccagcttgttgtcaccggcagtgatgcacacgaaaggatcggcggtctcctagctctt
gaccgactaatagatttcgatggcgtggacaatgcgcagaagacaacgaggttcgccagc
tatttgcggagcgccctgcgcagcagcgataatgccgtacttgtctacgccgctcgggca
cttggtcgcctggcgaagcccggtggtgcccttactgcagaattggttgagagtgaaata
cagtcggcactggaatggcttcagtctgaacgacaagaaggtcgacggtttgctgcggtg
ctggttattcgggagctcgctaaagggtcgcccacgcttctttacgggttcgttcctcag
atcttcgaactcatctgggttgctctgagagaccccaaggtacttatccgagagactgct
gcagaagcagttcggcagctatggtttgcgagaatatacgaggaagcgctccagggcttg
aagtcgaataatgtggactggatccatggatcactcttggttcttaaggaacttctcctc
aaaggagccatgttcatgaatgaacattatcgaaatgcgtgtgaaatcgtgcttcgtctc
aaggaccaccgagacccgaaaattcggacgcaagttgttctcacaattcccattcttgcc
tcctacgctccggttgatttcaccgaaacatacctgcatagattcatggtgtatcttcaa
gcccagctcaaaaaggacaaggagcgcaatgctgctttcatagctatcggaaagattgca
aatgcggtgggtgtagctattgcacaataccttgatggtatcattgtttacatccgcgaa
ggactggccctgaaagccaaaaatcgagctgccattaatgaagcgccaatgtttgagtgt
attagtatgctctcgctggctgttgggcaggctctcagcaaatacatggaatcgctcctc
gatcccatctttgcatgtggcttaagtgaatccctgacacaggctcttgttgatatggct
cattatattccaccaatcaagcccacgattcaagtaaagctgctggatatgcttagcctg
attcttgatgggacgccttttcgccccctaggttgtccggaaagcaggctacctccgctg
ccgtctttcgccaaagacttcaccctgcaagaactgcattctgacgctgaaattgcgctg
gctctccacaccctgggaagcttcgatttttctggtcatattttgaatgaatttgtgcgc
gacgttgccattcactatgttgaaaacgacaaccctgaaattcggaaggctgcggctctt
acctgctgccagctatttgtgcatgaccccattatcaatcagaccagcagccactcaata
caggttgttagcgaggtcatcgacaagctattgaccgttggtgtcggcgaccctgatcct
gagattagacgcactgtgctatggtccttggatcgcaaatttgaccggcaccttgcacgg
ccagaaaatatccgatgcctcttcttggccgtgaatgatgaagtgttcgctgtcagagag
gcagcgatctgcataattggccgcctttccagtgtcaacccagcctacgtattccctccc
ctaaggaagttgctggtgaacttgctcactggacttgggttcgcaagcactgctcgccag
aaggaagaaagtgcacagcttattagcctttttgtttcgaatgccacgaaacttatccgg
tcgtacgtcgaccctatggttacgactctgctaccgaaagcagttgatgccaatcacggc
gtcgcctccacaacactgaaagctgtcggagaacttgcaagcgttgggggcagcgatatg
aaagcctacctgcctaagctgatgccaatcgttctggatgccttgcaggacctttcatct
catgctaagagagaagcggctttgcgaacattgggccagatagccagcaactcaggctac
gttatcgacccgtacaccgaccaccctcatctgctggcggtgcttattggtatcatcaag
acggagcaggcaggatcgcttcgcaaggaaacgataaaagttctaggaattctaggtgca
ctggacccttataaataccagcaaataagcgaaaccgcaccagacgtccaccatatcaac
gaagtacaagtggtgtcagacgttagtcttattatgcaaggccttgccccttccaatgaa
gagtactacccaactgttgttatccatactctcatgcagaacatacttcgcgagaactcc
cttgcgcaatatcattctgctgtcatcgacgcgattgttacgatctttaagacccttggc
ttgaagtgtgtccccttccttggccagatcattcctggtttcatttctgtcattcgaggt
tcaccctcaagccggctcgaatcttatttcaaccaaatggcaatccttgtcaatattgtg
cggcagcacatcagagcctttcttcctgaaataattgaggtcattcgggaattctgggac
acgtcatatcaggttcaagcgaccattctctcgcttgtggacgcgatagccaagtccctt
gagggtgaatttaagaagtaccttgcaaatctcattcctccaatgctggacacactggaa
aaggataatactccgcgccgccagccttccgagaggattttgcatagcttcttagtattc
ggctccagtggcgaagagtacatgcatctgattgtgccctccattgtgcgtctgtttgat
aggtcccagaacccagcgagcatcagaaagtcagctattgacagcttgaccaaactttcg
cgacaagtgaatgtctccgattttgcgtccttgattgtacactccctttctcgagtcgtt
gccggcaacgaccgtatgttacgacaggctgctatggattgcatatgctctttgatattc
cagcttggccaggatttcaaccattatattcatctgctgaacaaggtcttgaagcatcat
caagtcaatcacgtgaactatcagatccttgtcacaaagctccagaaaggagacccgctc
ccacaggatctcaatcctgacgagagctatgccccattggcggatgacgcgaactatgca
gagatcggtcaaaagaagatggtggtcaatcaacaacatcttaagaacgcctgggacgct
tcgcaaaagtcgactcgcgaagactggcaagaatggatccggaggttcagtgtagagctt
ttgaaagaatcaccttcgccggcgctgcgtgcttgtgccagcctggcgggcatctaccaa
cccctcgctagggatctattcaatgccgctttcgtctcctgttggacggaattgtacgac
cagtaccaggaagagctggttcggtcaatcgaaaaagccctcacctcgccgaacattcca
ccggaaattcttcagatcttgctcaatcttgctgagtttatggagcacgacgacaaggcg
ctgccgattgatatccgcactcttggaaaatatgctgccaaatgtcacgcgttcgcaaag
gcgctccactacaaagaactcgagttcgagcaagatcagaactctggagctgtagaggca
ctcattactatcaacaatcagctccagcaatccgatgccgctattggtatccttcggaag
gctcaggcgtatcgggatgttgaactgaaggagacctggtttgagaaacttcagcgatgg
gaagaagcccttgcagcttacaaacgtcgtgagaagattgaccccgactctttcggtatc
acaatggggaaaatgcgctgtctacatgctcttggagaatggaaagtgttgtctgacctc
gctcaggagaagtggaaccaggcctctctagaacaccggaaatcaatcgctcctctcgct
gcggcagctgcatggggtcgcggtcaatgggagctgatggattcgtacctaggagttatg
aaagaacaatctcctgaccgttcgttctttggggcaatactggcaattcatcgcaaccaa
tttgatgaagccattatgtacatcgaaaaggcccggaacggccttgacacggaactctca
gcacttctcggagagtcatataaccgtgcctacaatgtagttgttcgcgttcaaatgctt
gctgaactcgaggagatcatcacctacaaacagaatgttggtgatcccgagagacaagag
gcaatgcgccagacctggaacaggcgacttctcggctgccagcagaatgtagaggtatgg
cagcgcatgctcaaggtcagagcacttgttacaacaccgcgagagaacctagacatgtgg
atcaagtttgccaatttgtgtcgcaaatcaaaccgcatggggttagcggaacgttctctc
gcctctctagaaactgtcatccctgacggcaacggcggcactcgcactatctccccacca
gaagtcacatatgctcgcttgaagtttagctgggcaactggccgccaacgcgaggccctt
catatgctccgtgaatttactgccaacctaacagaagacttcactcgcttcaatgcactt
gttgcctcacaatctgaccataacggtatcaacggcgttaatggtatcgcagaaggaaac
cataccgatatcatggcccttcgagagcgcgttggtgatgtcaacaagtttagaaagctc
cttgcaaagagttatctaagacttggtgagtggcaaacggctctacaacgaggggactgg
cggccagagcatgtccgcgaagtactcaacgcatattcagcagccaccaggtacaaccgc
gattcctacaaagcctggcactcatgggccctggccaactttgaggtcgtgacgacaatt
gccagccaggcaagtaaggacggcggaaatctggcattggttccagggcatatcgtaaca
gaacatgtgattcctgcgattcgcggcttttttaggtccattgccctctcttcgacgtcg
tctcttcaggatactcttcggttgctcactctctggttcaaccatggtggtgaccaggag
gtgaactcggtcgttacagagggtttcacggctgttaatatcgacacgtggctcgccgtc
actcctcagcttattgcccgcatcaatcagcccaacttcagggttcgcagcgccgttcat
cgcttgcttgctgaagttggcaaggcacatccccaagccctcgtgtatccgctcacagtt
gcgatgaagtcgaatgttgcccgacgatcacagtccgcaggcaacattatggagagcatg
cggacacacagtgcaaacctagtggagcaggctgatcttgtaagtcatgagctgattagg
gtcgctgttctgtggcacgaactctggcacgaaggactggaagaggcgtcacgtctctat
ttcggtgaccataacgtggatgggatgtttgcaactctcgcaccgcttcatgaaatgctt
gataaaggtgctgaaaccctgcgcgaagtatcgtttgcccaagctttcggacgtgacctg
gctgaggccaagcattactgcatgctctatcgcgagacggaagaaatcggtgacctaaac
caagcgtgggatttgtattacacagtgttccgcaaaatcagccgacagctaccacagtta
tcaaccctagatctcaaatacgtctcgcccaaactcaaggattgcgtggaccttgatctc
gctgttcctggtacctaccaaagtggcaggcccattatccgaatcatcagtttcgatcca
atcctacatgttcttcaaacgaagaagcgaccacggaggatgactttgaagggcagtgac
ggcagctcctacatgtatgtggtgaagggccacgaagatatccgacaagatgagagagtc
atgcagttattcggcctggtcaacactcttctcgataacgatagtgaaagcttcaagcgg
catctaacggtgcagcgcttcccggccattcctctgtctcagaactctggtatcatcggc
tgggtcaccaatagtgacaccctccatgctttgataaaagaataccgggaaacgcggcgt
attctcctcaacatcgagcataggatcatgttacagatggctccagactatgacaatcta
acgctcatgcagaaggttgaagtatttggctatgcgatggacaacacaaccgggaaggat
ctgtaccgtgttctgtggttgaagagtaagagctccgaagcctggcttgagcgtcgtacc
aactacactcgttcacttggagtcatgtccatggtcggctacatccttggtctaggtgac
cgccacccgtccaatcttcttctggacagagtgaccggcaaagtggttcatattgacttt
ggtgactgcttcgaagttgccatgcatcgtgaaaagtatccggagcgcgtgccattccgt
ttgacgcgtatgttgacgtttgcgatggaagtcagcaacattgaaggaagctaccggatc
acttgtgaagctgtcatgcgggtgatacgtgagaacaaggactcgctgatggccgttctg
gaggcttttattcacgaccctctaatcaactggcgtctgggaattcgcgagtctcctgac
cgaatgccatttaacgcggagcgtcgtcaatcgattgtctccaatgtcaacctcgagcac
ggcgtccaacccagcaacttctctcggcaccgtcggccttcaatccttgaaggtggtatt
ctcgacgctcaagaaggggtgcctaatgaggcacgtgaggctcagaatgcaagagcctta
caggtgcttgctcgggtgcgggagaagctgaccggccgggactttaagcctagcgaagag
ctcaatgttagcgatcaagttgacaagcttcttgcacaggcaactagtgttgagaacatc
tgtcagcattggattggatggtgcagtttctggtga

DBGET integrated database retrieval system