KEGG   Aspergillus nidulans: AN6032.2Help
Entry
AN6032.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ani  Aspergillus nidulans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AN6032.2
Enzymes [BR:ani01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AN6032.2
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AN6032.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 434 aa AA seqDB search
MDALKPSHRAFIALGSNVGERVEMIEKACLEMDRAGIKVQRTSSLFETAPMYYLDQEPFM
NGVCESIEVSLGRKKLIDKGPRSIDLDILLYDQQVFTHDRLNIPHKLMLERDFVLRPLSQ
LIPNEVPPFKGHKTTYLSHLASLPPPSPTPVATTYISPSFPPLRATDPSRRTHIMAILNL
TPDSFSDGGKHLAEPEAITSTVRSFIQSGATIIDIGGESTRPGSTPVGVDEELRRIIPAI
RHIRTSIPEAKNIAISVDTYRARVAAEALAAGADIINDVSAGLLDPEMLPTVAQSGKSII
LMHMRGSPSTMTKLTSYANGVISDVGTELLARVAAAEATGIRRWRIILDPGLGFAKNQAE
DLTILKDFAALRKTQGLEYFPWLMGPSRKRFIGRLTGVEKASERGWGTAATVTASVAGGA
DIMYKNLTEGTTDL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacgctctcaagccgtcacacagagcattcattgcgctgggcagtaatgttggcgag
cgagtcgagatgattgagaaagcttgtctggaaatggacagagccggcatcaaagtccaa
cgaaccagttccttgtttgaaaccgccccgatgtactatctcgaccaggaacccttcatg
aatggcgtttgcgagtccattgaggtcagtctcggccggaagaagttgatcgacaaagga
ccccggtcaatcgacctagacatccttctctatgaccaacaagtcttcactcacgaccgt
ctcaacatcccgcacaagcttatgctagagcgagattttgtcctccgacctctgagccaa
ctaattcccaacgaagtcccccccttcaaaggccacaaaacaacctacctctcccacctg
gcttccctccccccaccctcgcccacccccgtcgcgacaacctacatatccccatccttt
ccaccgctccgcgccacggacccctcccggcgcacgcacataatggcaatactaaaccta
accccggactctttctctgacgggggcaaacacctagcggagcctgaagcaataacctcc
acagtccgctcctttatccaatctggcgccacaattatcgatattggcggcgagagcaca
cggccgggttcaacacccgtcggggtagacgaagaactccgccgcattattccagccatc
cggcatatccgcacgtccatacctgaagcaaagaatatagccattagcgtcgacacatac
cgcgcccgcgtcgcagccgaagccctcgccgccggagcagacatcatcaatgacgtctcc
gctggtctcctagaccccgaaatgcttcccactgttgcacagtccggcaaatccattatc
ctaatgcacatgcgaggctccccttctacaatgacaaaactaacctcgtacgccaacggc
gtaatatccgatgtgggcacggaacttcttgcgcgtgtggcagccgctgaagcaacgggt
atcaggcggtggcggatcatactcgatcccgggctagggttcgcgaagaaccaggctgag
gatctgactatcctgaaggattttgcggcgctccggaaaacacaggggctggaatacttt
ccttggttgatggggccgagtcgcaagaggttcattgggaggctgacgggagtggagaag
gcgagtgagcgcggttggggcacagcggcgacagttacggccagtgtggctgggggtgcg
gacattatgtacaagaacctgactgaaggaacaacggatctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system