KEGG   Aspergillus nidulans: AN6126.2Help
Entry
AN6126.2          CDS       T01016                                 

Definition
similar to T30568 acetyl-CoA carboxylase (EC 6.4.1.2) - Emericella nidulans
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ani01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ani00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ani00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ani00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:ani00254]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 2288 aa AA seqDB search
MGVPDGTTNGHGGSRAAKHNLPSHFIGGNHLDAAAPSSVKDFVANHEGHSVITSVLIANN
GIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLAANADYIRMADQYVEVPGGTNNNN
YANVELIVDVAERMDVHAVWAGWGHASENPRLPESLAASPKKIIFIGPPASAMRSLGDKI
SSTIVAQHAQVPCIPWSGTGVDEVKVDENGIVTVEEEVYNKGCTFSPEEGLEKAKQIGFP
VMIKASEGGGGKGIRKVEKEEDFINLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQY
GNNISLFGRDCSVQRRHQKIIEEAPVTIANPTTFQAMERAAVSLGKLVGYVSAGTVEYLY
SHADDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPNT
SAEIDFDFSSEESFKTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWG
YFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVIALKELSIRGDFRTTIEYLIKLLE
TPAFEENKITTGWLDQLISNKLTAERPDTTIAVLCGAVTKAHQASEARLEEYRNGIQKGQ
VPSKDVLKTVFPVDFIYEGKRYKFTATRAGLDSYHLFINGSKCSIGVRALADGGLLVLLN
GRSHNVYWKEEAAATRISVDGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHVRAGQPF
AEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAQPFTEQLPPI
GPPQVVGNKPAQRFFLLHSILENILKGFDNQVIMNSTLKELIEVLRDPELPYSEWNAQSS
ALHSRMPQKLDAQLQNIVDRARSRKAEFPARQLQKTMVRFIEENVNPADAEILKTTLLPL
VQVINNYIEGLKAHEYKVFVGLLEQYYAVEKLFSGSKARYEDGILALREEHKDDVATIVQ
IALSHSRIGAKNDLILAILSIYRPNQPGMANVGQYFKSILKKLTEIESRAAAKVTLKARE
VLIQCALPSLEERLSQMELILRSSVAESQYGETGWAHREPDLGALKEVVDSKYTVFDVLP
RFFVHKDAWVTLAALEVYVRRAYRAYSIQGIQYHHEGEPAFLSWDFTMGKLGQPEFGSMT
AVTHPSTPSTPTTESNPFKRVSSISDMSNLLNDSPNGTPRKGVILPVQYLEDAEEYLTKA
LEVFPRAGTRKPSDHGLIASLEGKRRPAPRADSESTELTGVLNIAIRDIEELDDAQIVAQ
ISKLVSSFKDEFLARRIRRVTFICGKDGVYPSYYTFRGPNYEEDESIRHSEPALAFQLEL
NRLSKFKIKPVFTENRNIHVYEAIGKGPENDKALDKRYFVRAVVRPGRLRDDIPTAEYLT
SEADRLMNDILDALEVIGNNNSDLNHIFINFSPVFNLQPKDVEEALAGFLDRFGLRLWRL
RVTGAEIRILCTDPATGMPYPLRVIISNTVGYIIQVELYIEKKSEKGEWLLHSIGGTNKL
GSNHLRPVSTPYPTKEWLQPKRYKAHVMGTQYVYDFPELFREAFQNSWTKAIEKSPSLIE
RRPPLGECMEYSELVLDDTDNLVEISRGPGTNTHGMVGWIVTARTPEYPEGRRFIIVAND
ITFQIGSFGPLEDKFFHKCTELARKLGIPRVYLSANSGARIGMADELIPYFSVAWNDPAK
PEAGFKYLYLTPEVKKKFDASKQKEVITELIHDEGEERHKITTIIGAKDGLGVECLKGSG
LIAGATSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGRE
VYTSNLQLGGTQIMYRNGVSHMTAANDFDGVEKIVDWLAFVPEKKGSLPPIRPLADPWDR
DVSYHPPAKQAYDVRWLINGKEDEEGFLPGLFDAGSFEEALGGWARTVVVGRARLGGIPM
GVIAVETRSVENVTPADPANPDSMEMITQEAGGVWYPNSSFKTAQALRDFNNGEQLPVMI
LANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVVDPTINP
DQMEMYADEEARGGVLEPEGIVNIKFRRDKQLETMARLDPTYGELRRALQDKNLSKEKLS
DIKDKMAAREEQLLPVYMQIALQFADLHDRAGRMQAKNTIRQALSWKNARRFFYWRVRRR
ISEEYIIKRMLTACPAPVQGEGSGAVAQGVSPAPSDSPRTTHLRTLHSWTPFLENEVEND
DRRVAVWYEENKELIQEKIEALKSQAIASQISDVLFSNRESGLKGIQQALSFLPVEEKES
ILKYLGSN
NT seq 6867 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcccagacggtacaacaaacggccacggaggctctcgagccgccaaacacaac
ctcccctcacatttcattggtggcaaccacttagacgctgctgccccaagcagcgtcaag
gactttgtcgctaaccatgaaggtcactccgtcatcacctcggtccttatcgcgaataac
ggtattgcggccgtcaaggagattcgatctgtccgaaaatgggcctacgagacattcggc
aacgagcgtgccattcaattcacagtgatggcaaccccagaagatctggcggcgaacgcc
gactatatccgtatggctgatcaatatgttgaggtccctggtggtacgaataacaacaac
tacgccaacgtcgagctgattgtggatgtggctgaacggatggacgttcacgccgtctgg
gccggttggggtcacgcctctgagaacccccggttaccagaatctctagccgcttctccc
aaaaagatcatctttattggacctcccgcctctgcgatgcgatctcttggtgacaagatt
tcctctactatcgtcgctcagcacgctcaggtaccgtgcattccgtggtctggaaccggt
gtagatgaggtgaaggttgatgagaacggcatcgttacggtggaggaagaggtttacaac
aagggatgcacattctctccggaagagggtctagagaaagccaagcagattggattcccc
gtcatgattaaagcctccgagggtggcggtggtaagggtatccgtaaggttgagaaggaa
gaggactttatcaacctgtacaatgctgcggcgaatgagattcctgggtcacctatcttc
atcatgaagcttgccggtaacgcccgccacttggaagtgcagttgttggctgaccagtac
ggtaacaatatttcgcttttcggtcgtgactgttccgtgcagcgacggcaccagaagatt
attgaggaggcgccagtaaccattgcgaaccctacaactttccaggccatggaacgtgcc
gccgtgagcttgggtaagcttgtcggttacgtctccgccggtacggttgagtacctgtac
tctcacgctgatgacaaattttacttcctggagctcaacccgcgtctgcaggtcgagcat
cccaccactgaaatggtcactggtgtcaacttgcccgctgcccagctccagattgccatg
ggtatccctctgcaccgtatccgtgacattcgtctgctttatggcgttgaccccaataca
tcggcggagatagacttcgacttttccagcgaagagagcttcaagactcagcgccgtcct
cagcccaagggacacaccaccgcttgccgtatcacttccgaagatcctggtgagggtttc
aagccctctagcggaaccatgcacgagttgaacttccgaagttcatctaacgtttggggt
tacttctctgtcggaacagcgggtggtatccacagtttctccgacagccagttcggtcac
atcttcgcgtacggagagaaccgctccgcctcgcgaaagcacatggtcattgccctgaaa
gaattgagcattcgtggtgatttccggacgacaattgagtacctgatcaagctcttggag
acgccagcttttgaggaaaacaagatcaccactggttggttggatcagctgatttccaac
aagctgactgcagagcgtcccgatacaacgatcgctgtgctctgcggtgctgtcactaaa
gcccatcaggctagcgaggcgcgccttgaagagtaccgtaacggcattcagaagggtcag
gttccctctaaggatgtcctgaaaaccgtcttccccgtggacttcatctacgagggtaag
cggtacaagttcactgccacccgtgccggtcttgacagctatcacctcttcatcaacggt
tctaagtgctcgattggtgtgcgtgccttggctgacggtggactactcgtcctcctcaac
ggtcggagccataacgtatactggaaggaggaggccgctgctacccgtattagtgtggac
ggcaagacttgcttgctcgagcaggagaatgatcctactcaacttcgtactccctctccc
ggaaagttggtcaagttcaccgtcgagaacggagagcatgtccgcgccggtcagcctttt
gctgaagttgaagtcatgaagatgtacatgcctctgatcgcccaggaggacggtattgtc
cagctcatcaagcagcccggtgccacccttgaggctggtgacattcttggtatccttgcc
cttgacgatccatcccgtgtcaagcatgctcagccgttcaccgagcagcttcccccaatt
ggaccccctcaggtcgttggtaataagcctgctcaacgatttttcctcttgcacagcatt
ttggagaacatcttgaagggtttcgacaaccaggttattatgaactctactctcaaggag
ctcatcgaggtccttcgcgaccccgagttgccttacagcgaatggaacgcccagtcttcc
gccctccactcccgcatgccccagaaattggatgctcagcttcaaaacattgttgaccgc
gctcggtcacgcaaggccgagtttccggccaggcagctgcagaagactatggtccgattc
attgaagagaatgtcaaccctgctgacgccgagatcctgaagactacacttcttcctttg
gttcaggttattaataactacatcgaaggcttgaaggcgcacgaatacaaggtgttcgtt
ggacttctcgagcagtactacgctgtggagaagctgttctctggcagcaaagctcgatat
gaggatggtatcctcgccctccgtgaggagcacaaggatgatgttgccactattgtgcag
atcgccctgtctcacagccgcatcggcgccaagaacgacctcatcctcgcgatcctgtcg
atctaccgtcccaaccagcctggaatggccaatgtgggccagtacttcaagtcgattctg
aagaaactgactgaaattgagtcgcgtgctgcggccaaggtcaccctgaaggctcgtgaa
gtcctcattcagtgcgctctgccttcgctggaggagcgtctttctcagatggagctcatt
ctgcgctcctctgttgcggagtctcagtacggcgagaccggctgggcccaccgtgagccc
gatctcggtgccctcaaggaggttgtcgattccaaatacaccgtgttcgacgttctgcca
cgcttctttgttcacaaggatgcgtgggtcactttggcggctctcgaagtctatgtgcgc
cgcgcctaccgtgcttactcaattcagggtatccagtatcaccacgagggcgagccagca
ttcctgtcttgggacttcacaatgggcaagctgggtcagcctgagttcggttccatgact
gctgtcacccacccctccacgccaagcacgcctaccactgaatcaaaccccttcaagcgc
gtctcctcaatcagtgacatgtccaacttgctaaatgacagccccaacgggactcccaga
aagggtgtcatccttcctgtacagtacctcgaagatgccgaagagtacctcaccaaggct
ttggaagtgttcccaagggctggcactaggaagcctagcgaccatggcctaattgcctct
cttgaggggaagcgccgtccggctccccgtgctgacagtgagtctactgagctgaccgga
gtcttaaacatcgccatccgtgacatcgaggagcttgatgatgcccagatcgttgcccag
atcagtaagctcgtttctagcttcaaggacgagttccttgcgcgccgcattcgtcgtgtg
acgttcatctgcggcaaggatggtgtctaccccagctactacaccttcagaggtcccaac
tacgaagaggatgagagtatccgccacagcgagcctgccctggccttccagctcgaactc
aaccgtctttccaagttcaagatcaagcccgtattcacagagaacaggaacatccatgtc
tacgaggcgattggcaaggggcctgagaacgataaggctttggacaaacggtacttcgtt
cgcgctgtcgtccgtcccggccgactccgtgacgatatccccactgcggagtaccttacc
tcggaagctgaccgtttgatgaacgacattcttgatgcccttgaggtcattggcaacaac
aactccgatctcaaccacatcttcatcaacttctcccccgtcttcaacttacagcccaaa
gatgtggaagaggcattagcaggcttcttggatcgcttcggccttcgcctttggcgcctt
cgtgtcactggtgccgagatccgcattctatgcaccgatcccgccactggcatgccatac
cctctgcgtgtgatcattagcaacactgttggctatatcatccaggttgagctttacatt
gagaaaaagtccgagaagggcgagtggcttcttcacagcattggtggcactaacaagctt
ggatccaaccacttgcgtccggtttccaccccttaccctaccaaggagtggctgcagcct
aagcgctacaaggctcacgtcatgggtactcaatatgtgtacgacttccctgagctcttc
cgtgaagctttccagaactcgtggaccaaggccatagagaagagcccgagcttgatcgag
cgtcgtcctcctcttggcgagtgcatggaatacagcgagcttgtcttagacgatactgac
aacctggttgagatttctcgcggccctggcaccaacacccacggtatggttggatggata
gttactgctcgcacccccgagtatcccgagggcagacgcttcatcattgttgcgaatgac
attaccttccagatcggttcgttcggtccattggaagacaagttcttccacaaatgtacc
gaattggctcgtaagctcggaatccctcgtgtctacctttctgccaactctggtgctcgc
attggtatggcggatgagctcatcccatacttctccgttgcttggaacgaccctgctaag
cctgaggctggcttcaagtacctttacctcacacctgaggtgaagaagaagttcgacgca
agcaagcagaaggaggttatcactgaactgattcacgatgagggtgaggagcgccacaag
atcaccaccattatcggtgccaaggatggtcttggagtcgagtgtcttaagggttctggt
ctcattgctggtgccacttcccgcgcttacgaagacatttttaccattactctcgtcacc
tgccgttcagtcggtattggtgcctaccttgtccgtcttggacaaagagctattcaggtt
gagggccagcctatcattcttactggtgctcctgccatcaacaagctgctaggaagagag
gtctatacttccaacctgcagcttggtggtactcagatcatgtacaggaacggtgtttct
cacatgaccgctgctaacgacttcgatggtgtcgagaaaattgtcgactggcttgccttc
gtccccgaaaagaagggctctctgccacccatccgaccactcgccgacccttgggatcgt
gacgtttcttaccaccctcctgcaaagcaagcctacgatgtccgttggctcatcaatggt
aaggaagacgaggaaggcttcctccctggtcttttcgacgccggctccttcgaggaggct
cttggtggctgggctcgcactgtcgttgttggtcgtgctagacttggtggcatccccatg
ggtgttatcgctgtcgagacacgctctgtggagaacgttactccggctgatcctgctaac
cccgactctatggaaatgatcacccaggaagcgggcggtgtctggtaccctaactcgtcc
ttcaagactgcccaggccctccgggacttcaacaacggcgagcagcttcccgttatgata
ttggctaactggagaggtttctctggtggacaacgtgacatgtacaacgaggttctgaag
tacggttcctacatcgtggatgctctcgtcaaatacgagcagcctattttcgtgtacatt
cctccgttcggtgaactccgtggtggttcttgggtcgttgtcgaccctaccatcaacccc
gaccagatggaaatgtacgccgatgaggaggcccgtggtggtgtcctggagcccgagggt
atcgttaacatcaaattccgccgcgacaagcagttggagaccatggctcgtttggaccct
acttacggagaacttcgccgcgctcttcaggacaagaacctcagcaaggagaaactttcc
gacatcaaggacaaaatggcggcacgcgaggagcaactccttcctgtttacatgcagatt
gcattgcagtttgccgatctgcacgatcgtgctggccgcatgcaagccaagaacaccatc
cgccaagccctctcctggaagaacgctcgtcgcttcttctactggcgtgttcgccgccgt
attagcgaggagtacattatcaagcgcatgctcaccgcatgccctgctcctgttcagggt
gaaggcagcggagctgtcgcccagggtgtgtcgcctgcccctagcgactcccctcgcacc
acccatctccgcactttgcactcatggactcccttccttgagaacgaggttgagaatgac
gaccgtcgcgtcgccgtctggtatgaggagaacaaggagcttatccaggagaagattgaa
gctctcaagtctcaagccatcgcttcccagatctccgacgtcctcttcagcaaccgcgaa
agcggcctcaagggcattcagcaggctctcagcttcctccctgttgaagagaaagagtcc
attctcaaatacctcggatccaactag

DBGET integrated database retrieval system