KEGG   Aspergillus nidulans: AN6126.2Help
Entry
AN6126.2          CDS       T01016                                 

Definition
similar to T30568 acetyl-CoA carboxylase (EC 6.4.1.2) - Emericella nidulans
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AN6126.2
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AN6126.2
   00640 Propanoate metabolism
    AN6126.2
  Lipid metabolism
   00061 Fatty acid biosynthesis
    AN6126.2
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AN6126.2
Enzymes [BR:ani01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AN6126.2
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AN6126.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 2288 aa AA seqDB search
MGVPDGTTNGHGGSRAAKHNLPSHFIGGNHLDAAAPSSVKDFVANHEGHSVITSVLIANN
GIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLAANADYIRMADQYVEVPGGTNNNN
YANVELIVDVAERMDVHAVWAGWGHASENPRLPESLAASPKKIIFIGPPASAMRSLGDKI
SSTIVAQHAQVPCIPWSGTGVDEVKVDENGIVTVEEEVYNKGCTFSPEEGLEKAKQIGFP
VMIKASEGGGGKGIRKVEKEEDFINLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQY
GNNISLFGRDCSVQRRHQKIIEEAPVTIANPTTFQAMERAAVSLGKLVGYVSAGTVEYLY
SHADDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPNT
SAEIDFDFSSEESFKTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWG
YFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVIALKELSIRGDFRTTIEYLIKLLE
TPAFEENKITTGWLDQLISNKLTAERPDTTIAVLCGAVTKAHQASEARLEEYRNGIQKGQ
VPSKDVLKTVFPVDFIYEGKRYKFTATRAGLDSYHLFINGSKCSIGVRALADGGLLVLLN
GRSHNVYWKEEAAATRISVDGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHVRAGQPF
AEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAQPFTEQLPPI
GPPQVVGNKPAQRFFLLHSILENILKGFDNQVIMNSTLKELIEVLRDPELPYSEWNAQSS
ALHSRMPQKLDAQLQNIVDRARSRKAEFPARQLQKTMVRFIEENVNPADAEILKTTLLPL
VQVINNYIEGLKAHEYKVFVGLLEQYYAVEKLFSGSKARYEDGILALREEHKDDVATIVQ
IALSHSRIGAKNDLILAILSIYRPNQPGMANVGQYFKSILKKLTEIESRAAAKVTLKARE
VLIQCALPSLEERLSQMELILRSSVAESQYGETGWAHREPDLGALKEVVDSKYTVFDVLP
RFFVHKDAWVTLAALEVYVRRAYRAYSIQGIQYHHEGEPAFLSWDFTMGKLGQPEFGSMT
AVTHPSTPSTPTTESNPFKRVSSISDMSNLLNDSPNGTPRKGVILPVQYLEDAEEYLTKA
LEVFPRAGTRKPSDHGLIASLEGKRRPAPRADSESTELTGVLNIAIRDIEELDDAQIVAQ
ISKLVSSFKDEFLARRIRRVTFICGKDGVYPSYYTFRGPNYEEDESIRHSEPALAFQLEL
NRLSKFKIKPVFTENRNIHVYEAIGKGPENDKALDKRYFVRAVVRPGRLRDDIPTAEYLT
SEADRLMNDILDALEVIGNNNSDLNHIFINFSPVFNLQPKDVEEALAGFLDRFGLRLWRL
RVTGAEIRILCTDPATGMPYPLRVIISNTVGYIIQVELYIEKKSEKGEWLLHSIGGTNKL
GSNHLRPVSTPYPTKEWLQPKRYKAHVMGTQYVYDFPELFREAFQNSWTKAIEKSPSLIE
RRPPLGECMEYSELVLDDTDNLVEISRGPGTNTHGMVGWIVTARTPEYPEGRRFIIVAND
ITFQIGSFGPLEDKFFHKCTELARKLGIPRVYLSANSGARIGMADELIPYFSVAWNDPAK
PEAGFKYLYLTPEVKKKFDASKQKEVITELIHDEGEERHKITTIIGAKDGLGVECLKGSG
LIAGATSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGRE
VYTSNLQLGGTQIMYRNGVSHMTAANDFDGVEKIVDWLAFVPEKKGSLPPIRPLADPWDR
DVSYHPPAKQAYDVRWLINGKEDEEGFLPGLFDAGSFEEALGGWARTVVVGRARLGGIPM
GVIAVETRSVENVTPADPANPDSMEMITQEAGGVWYPNSSFKTAQALRDFNNGEQLPVMI
LANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVVDPTINP
DQMEMYADEEARGGVLEPEGIVNIKFRRDKQLETMARLDPTYGELRRALQDKNLSKEKLS
DIKDKMAAREEQLLPVYMQIALQFADLHDRAGRMQAKNTIRQALSWKNARRFFYWRVRRR
ISEEYIIKRMLTACPAPVQGEGSGAVAQGVSPAPSDSPRTTHLRTLHSWTPFLENEVEND
DRRVAVWYEENKELIQEKIEALKSQAIASQISDVLFSNRESGLKGIQQALSFLPVEEKES
ILKYLGSN
NT seq 6867 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcccagacggtacaacaaacggccacggaggctctcgagccgccaaacacaac
ctcccctcacatttcattggtggcaaccacttagacgctgctgccccaagcagcgtcaag
gactttgtcgctaaccatgaaggtcactccgtcatcacctcggtccttatcgcgaataac
ggtattgcggccgtcaaggagattcgatctgtccgaaaatgggcctacgagacattcggc
aacgagcgtgccattcaattcacagtgatggcaaccccagaagatctggcggcgaacgcc
gactatatccgtatggctgatcaatatgttgaggtccctggtggtacgaataacaacaac
tacgccaacgtcgagctgattgtggatgtggctgaacggatggacgttcacgccgtctgg
gccggttggggtcacgcctctgagaacccccggttaccagaatctctagccgcttctccc
aaaaagatcatctttattggacctcccgcctctgcgatgcgatctcttggtgacaagatt
tcctctactatcgtcgctcagcacgctcaggtaccgtgcattccgtggtctggaaccggt
gtagatgaggtgaaggttgatgagaacggcatcgttacggtggaggaagaggtttacaac
aagggatgcacattctctccggaagagggtctagagaaagccaagcagattggattcccc
gtcatgattaaagcctccgagggtggcggtggtaagggtatccgtaaggttgagaaggaa
gaggactttatcaacctgtacaatgctgcggcgaatgagattcctgggtcacctatcttc
atcatgaagcttgccggtaacgcccgccacttggaagtgcagttgttggctgaccagtac
ggtaacaatatttcgcttttcggtcgtgactgttccgtgcagcgacggcaccagaagatt
attgaggaggcgccagtaaccattgcgaaccctacaactttccaggccatggaacgtgcc
gccgtgagcttgggtaagcttgtcggttacgtctccgccggtacggttgagtacctgtac
tctcacgctgatgacaaattttacttcctggagctcaacccgcgtctgcaggtcgagcat
cccaccactgaaatggtcactggtgtcaacttgcccgctgcccagctccagattgccatg
ggtatccctctgcaccgtatccgtgacattcgtctgctttatggcgttgaccccaataca
tcggcggagatagacttcgacttttccagcgaagagagcttcaagactcagcgccgtcct
cagcccaagggacacaccaccgcttgccgtatcacttccgaagatcctggtgagggtttc
aagccctctagcggaaccatgcacgagttgaacttccgaagttcatctaacgtttggggt
tacttctctgtcggaacagcgggtggtatccacagtttctccgacagccagttcggtcac
atcttcgcgtacggagagaaccgctccgcctcgcgaaagcacatggtcattgccctgaaa
gaattgagcattcgtggtgatttccggacgacaattgagtacctgatcaagctcttggag
acgccagcttttgaggaaaacaagatcaccactggttggttggatcagctgatttccaac
aagctgactgcagagcgtcccgatacaacgatcgctgtgctctgcggtgctgtcactaaa
gcccatcaggctagcgaggcgcgccttgaagagtaccgtaacggcattcagaagggtcag
gttccctctaaggatgtcctgaaaaccgtcttccccgtggacttcatctacgagggtaag
cggtacaagttcactgccacccgtgccggtcttgacagctatcacctcttcatcaacggt
tctaagtgctcgattggtgtgcgtgccttggctgacggtggactactcgtcctcctcaac
ggtcggagccataacgtatactggaaggaggaggccgctgctacccgtattagtgtggac
ggcaagacttgcttgctcgagcaggagaatgatcctactcaacttcgtactccctctccc
ggaaagttggtcaagttcaccgtcgagaacggagagcatgtccgcgccggtcagcctttt
gctgaagttgaagtcatgaagatgtacatgcctctgatcgcccaggaggacggtattgtc
cagctcatcaagcagcccggtgccacccttgaggctggtgacattcttggtatccttgcc
cttgacgatccatcccgtgtcaagcatgctcagccgttcaccgagcagcttcccccaatt
ggaccccctcaggtcgttggtaataagcctgctcaacgatttttcctcttgcacagcatt
ttggagaacatcttgaagggtttcgacaaccaggttattatgaactctactctcaaggag
ctcatcgaggtccttcgcgaccccgagttgccttacagcgaatggaacgcccagtcttcc
gccctccactcccgcatgccccagaaattggatgctcagcttcaaaacattgttgaccgc
gctcggtcacgcaaggccgagtttccggccaggcagctgcagaagactatggtccgattc
attgaagagaatgtcaaccctgctgacgccgagatcctgaagactacacttcttcctttg
gttcaggttattaataactacatcgaaggcttgaaggcgcacgaatacaaggtgttcgtt
ggacttctcgagcagtactacgctgtggagaagctgttctctggcagcaaagctcgatat
gaggatggtatcctcgccctccgtgaggagcacaaggatgatgttgccactattgtgcag
atcgccctgtctcacagccgcatcggcgccaagaacgacctcatcctcgcgatcctgtcg
atctaccgtcccaaccagcctggaatggccaatgtgggccagtacttcaagtcgattctg
aagaaactgactgaaattgagtcgcgtgctgcggccaaggtcaccctgaaggctcgtgaa
gtcctcattcagtgcgctctgccttcgctggaggagcgtctttctcagatggagctcatt
ctgcgctcctctgttgcggagtctcagtacggcgagaccggctgggcccaccgtgagccc
gatctcggtgccctcaaggaggttgtcgattccaaatacaccgtgttcgacgttctgcca
cgcttctttgttcacaaggatgcgtgggtcactttggcggctctcgaagtctatgtgcgc
cgcgcctaccgtgcttactcaattcagggtatccagtatcaccacgagggcgagccagca
ttcctgtcttgggacttcacaatgggcaagctgggtcagcctgagttcggttccatgact
gctgtcacccacccctccacgccaagcacgcctaccactgaatcaaaccccttcaagcgc
gtctcctcaatcagtgacatgtccaacttgctaaatgacagccccaacgggactcccaga
aagggtgtcatccttcctgtacagtacctcgaagatgccgaagagtacctcaccaaggct
ttggaagtgttcccaagggctggcactaggaagcctagcgaccatggcctaattgcctct
cttgaggggaagcgccgtccggctccccgtgctgacagtgagtctactgagctgaccgga
gtcttaaacatcgccatccgtgacatcgaggagcttgatgatgcccagatcgttgcccag
atcagtaagctcgtttctagcttcaaggacgagttccttgcgcgccgcattcgtcgtgtg
acgttcatctgcggcaaggatggtgtctaccccagctactacaccttcagaggtcccaac
tacgaagaggatgagagtatccgccacagcgagcctgccctggccttccagctcgaactc
aaccgtctttccaagttcaagatcaagcccgtattcacagagaacaggaacatccatgtc
tacgaggcgattggcaaggggcctgagaacgataaggctttggacaaacggtacttcgtt
cgcgctgtcgtccgtcccggccgactccgtgacgatatccccactgcggagtaccttacc
tcggaagctgaccgtttgatgaacgacattcttgatgcccttgaggtcattggcaacaac
aactccgatctcaaccacatcttcatcaacttctcccccgtcttcaacttacagcccaaa
gatgtggaagaggcattagcaggcttcttggatcgcttcggccttcgcctttggcgcctt
cgtgtcactggtgccgagatccgcattctatgcaccgatcccgccactggcatgccatac
cctctgcgtgtgatcattagcaacactgttggctatatcatccaggttgagctttacatt
gagaaaaagtccgagaagggcgagtggcttcttcacagcattggtggcactaacaagctt
ggatccaaccacttgcgtccggtttccaccccttaccctaccaaggagtggctgcagcct
aagcgctacaaggctcacgtcatgggtactcaatatgtgtacgacttccctgagctcttc
cgtgaagctttccagaactcgtggaccaaggccatagagaagagcccgagcttgatcgag
cgtcgtcctcctcttggcgagtgcatggaatacagcgagcttgtcttagacgatactgac
aacctggttgagatttctcgcggccctggcaccaacacccacggtatggttggatggata
gttactgctcgcacccccgagtatcccgagggcagacgcttcatcattgttgcgaatgac
attaccttccagatcggttcgttcggtccattggaagacaagttcttccacaaatgtacc
gaattggctcgtaagctcggaatccctcgtgtctacctttctgccaactctggtgctcgc
attggtatggcggatgagctcatcccatacttctccgttgcttggaacgaccctgctaag
cctgaggctggcttcaagtacctttacctcacacctgaggtgaagaagaagttcgacgca
agcaagcagaaggaggttatcactgaactgattcacgatgagggtgaggagcgccacaag
atcaccaccattatcggtgccaaggatggtcttggagtcgagtgtcttaagggttctggt
ctcattgctggtgccacttcccgcgcttacgaagacatttttaccattactctcgtcacc
tgccgttcagtcggtattggtgcctaccttgtccgtcttggacaaagagctattcaggtt
gagggccagcctatcattcttactggtgctcctgccatcaacaagctgctaggaagagag
gtctatacttccaacctgcagcttggtggtactcagatcatgtacaggaacggtgtttct
cacatgaccgctgctaacgacttcgatggtgtcgagaaaattgtcgactggcttgccttc
gtccccgaaaagaagggctctctgccacccatccgaccactcgccgacccttgggatcgt
gacgtttcttaccaccctcctgcaaagcaagcctacgatgtccgttggctcatcaatggt
aaggaagacgaggaaggcttcctccctggtcttttcgacgccggctccttcgaggaggct
cttggtggctgggctcgcactgtcgttgttggtcgtgctagacttggtggcatccccatg
ggtgttatcgctgtcgagacacgctctgtggagaacgttactccggctgatcctgctaac
cccgactctatggaaatgatcacccaggaagcgggcggtgtctggtaccctaactcgtcc
ttcaagactgcccaggccctccgggacttcaacaacggcgagcagcttcccgttatgata
ttggctaactggagaggtttctctggtggacaacgtgacatgtacaacgaggttctgaag
tacggttcctacatcgtggatgctctcgtcaaatacgagcagcctattttcgtgtacatt
cctccgttcggtgaactccgtggtggttcttgggtcgttgtcgaccctaccatcaacccc
gaccagatggaaatgtacgccgatgaggaggcccgtggtggtgtcctggagcccgagggt
atcgttaacatcaaattccgccgcgacaagcagttggagaccatggctcgtttggaccct
acttacggagaacttcgccgcgctcttcaggacaagaacctcagcaaggagaaactttcc
gacatcaaggacaaaatggcggcacgcgaggagcaactccttcctgtttacatgcagatt
gcattgcagtttgccgatctgcacgatcgtgctggccgcatgcaagccaagaacaccatc
cgccaagccctctcctggaagaacgctcgtcgcttcttctactggcgtgttcgccgccgt
attagcgaggagtacattatcaagcgcatgctcaccgcatgccctgctcctgttcagggt
gaaggcagcggagctgtcgcccagggtgtgtcgcctgcccctagcgactcccctcgcacc
acccatctccgcactttgcactcatggactcccttccttgagaacgaggttgagaatgac
gaccgtcgcgtcgccgtctggtatgaggagaacaaggagcttatccaggagaagattgaa
gctctcaagtctcaagccatcgcttcccagatctccgacgtcctcttcagcaaccgcgaa
agcggcctcaagggcattcagcaggctctcagcttcctccctgttgaagagaaagagtcc
attctcaaatacctcggatccaactag

DBGET integrated database retrieval system