KEGG   Aspergillus nidulans: AN6138.2Help
Entry
AN6138.2          CDS       T01016                                 

Definition
BIMA_EMENI Protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ani  Aspergillus nidulans
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AN6138.2
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AN6138.2
   04113 Meiosis - yeast
    AN6138.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AN6138.2
Ubiquitin system [BR:ani04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     AN6138.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 788 aa AA seqDB search
MTPSTSHISSQLRQLIYYHLDNNLARNALFLAGRLHAYEPRTSEASYLLALCYLQNGQVK
AAWETSKHFGSRGAHLGCSYVYAQACLDLGKYTDGINALERSKGQWTSRNHWNKHSETRR
QHLPDAAAVLCLQGKLWQAHKEHNKAVECYAAALKLNPFMWDAFLNLCETGVDLRVSNIY
KMSPELYSMVSSAALEDVESQVLPPDGPLQTQVNPNPSLDPFTAGTTRSDSTSTHGSSAL
WEKLNGSTVSVASSGTGPHLPREGMETPGGQSSESDDPRVTNGNGTDVFEPPLAPAKKNR
TIQTIGGDHPMDPPPKMRPTGIRPRTRTKFESDEGHTERDAGMGHRLGDRKRTVSGQVAH
PSVPHSTDQGVGQRRSVRLFNQIKPSTNKISSTALGVKEGREVKKVRTTGNKARTTTSSN
VGRVVSGNNRRHAGEIHDGDSKEYRGTSSTSNGSQNASSKLAISERTKSVEALAWILDLF
FKIASGYFCLSRYKCSDAIQIFSSLSQGQRETPWVLAQIGRAYYEQAMYTEAEKYFVRVK
AMAPSRLEDMEIYSTVLWHLKNDVELAYLAHELMDVDRLSPEAWCAVGNSFSHQRDHDQA
LKCFKRATQLDPHFAYGFTLQGHEYADSRHYNAWYGLGTVYDKMGKLDFAEQHFRNAAKI
NPSNAVLICCIGLVLEKMNNPKSALIQYNRACTLAPHSVLARFRKARALMKLQDLKSALT
ELKVLKDMAPDEANVHYLLGKLYKMLRDKGNAIKHFTTALNLDPKAAQYIKDAMEALDDD
EEDEEDMA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgactccgtccacatcacatatttcgagccagctaaggcagctgatatattaccatctt
gacaacaaccttgctcggaacgcgctgttccttgccggtcgtttacacgcctacgaacct
cggacgtcggaagcttcgtacctattagctctgtgttacctacaaaatggtcaggtgaaa
gcagcatgggaaactagcaagcattttgggtcgaggggtgcgcatcttggatgttcttac
gtctacgcgcaggcttgtcttgacctcgggaaatatacggacggtattaacgcgctagag
cgaagtaagggacaatggacttcgcgaaaccactggaataaacacagtgagacgcgacga
caacacttgccggatgctgcggcagttttatgtttgcaaggaaaattatggcaggcacac
aaggaacacaacaaggctgtggagtgttacgctgcagctttaaagctgaatcccttcatg
tgggatgcattcttgaatctgtgcgaaactggtgttgatttgcgtgtttcaaacatatat
aagatgagcccggaattgtacagcatggtatcgtctgctgcgctcgaagatgttgaatcc
caggttctacctccggacggtccactccagacacaagttaacccaaatccgagcttggac
ccgttcactgccggtacgactcgcagcgattcgacctctactcacgggagctcagctttg
tgggaaaagttgaatggaagcacagttagtgtggcatcttcaggaacaggaccgcatctt
ccgcgggaaggcatggagactcctggtggccaaagtagcgaatctgatgatccacgtgta
accaacggtaatggcacagatgtttttgagccgccgctagcccctgcaaagaagaatcga
acgatccaaacaataggcggcgatcatccgatggatcccccgccaaagatgcggccaacc
ggtattcgaccgaggacccgaaccaaattcgagtcagatgaaggtcatactgagagagac
gcgggcatgggtcacaggttaggcgatcggaaacgaacggtctctggacaagttgcgcat
ccgtcggtaccgcattcaaccgaccaaggtgtcgggcaacggcgaagtgtacgtctcttt
aaccagataaagccatcaacgaacaaaatatctagcacggcattaggagtgaaagagggc
cgggaggtgaaaaaggtgagaactacggggaataaggcgcgcacaacaacaagctcaaat
gtgggccgtgttgttagcggcaacaatcgacgacacgctggggagatccatgacggagac
agcaaagaataccgtggaacatcttcaacatcaaatggctctcagaacgcatcgtctaag
ctcgctatatctgagcggaccaaatcggttgaagccttggcttggattttggacttgttt
ttcaagatagcctccggctatttctgtctcagccggtacaaatgctccgatgctatccag
attttcagctctctatcccagggccaacgggagacaccgtgggttcttgctcaaattgga
cgagcttactacgagcaagcaatgtatacagaggccgagaaatactttgtccgggtgaag
gccatggcgccttcccggttagaagatatggagatctactcgacggttctttggcatttg
aagaatgatgtcgaacttgcttacctggcccatgagttaatggatgtcgatcgcttatca
ccagaagcttggtgtgctgtcggtaactcgttctcacaccagcgggaccacgatcaagct
ctgaagtgcttcaagcgtgccactcaattggatcctcatttcgcgtatgggttcacgcta
cagggccatgagtatgcggacagtcgacattataatgcctggtacgggctgggaacggtc
tacgataagatgggcaaacttgactttgctgaacagcacttccgtaatgcggccaagatt
aatccttctaatgctgttttaatatgctgcattggcttggtcttagagaagatgaacaat
ccgaagtcagcgttgatccagtacaacagggcctgcaccctcgcgcctcattctgttctt
gctcgattccgaaaagcccgtgcgttgatgaaattgcaggatctcaagtcagcgcttacg
gagctgaaggttctgaaggacatggcgccggatgaggcaaacgttcattacctcctgggc
aaactgtataagatgcttcgtgacaagggaaatgccattaagcacttcacaactgcatta
aaccttgatcccaaggcggcgcagtacatcaaagatgcaatggaagcccttgacgacgat
gaagaggatgaagaagatatggcgtga

DBGET integrated database retrieval system