KEGG   Aspergillus nidulans: AN6147.2Help
Entry
AN6147.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ani  Aspergillus nidulans
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AN6147.2
Enzymes [BR:ani01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AN6147.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 641 aa AA seqDB search
MPSSKARSSPSVDRRERLTLAKLASYDDVATDALVDCAYFWTKTRKNRTKYIPVRGLAED
TVAHILLHDVIVAKDVSAAERKILDLIGMKRYLAKLPNDREKDWFRKHLRKYIQMYLPDC
PFEVTTTNRYTITEHEAAICARKFIPQGQEIKYLSGTLVPMTKEEERDLDLKRKDFSIVM
SSRRKTPSFFLGPARFANHDCSANGRLVTRGSEGMQVVATRDIYIGEEITVSYGEDYFGI
DNCECLCLSCERVPRNGWSQNLAPGPQSKPSTPEPKASEDHLTPRKRKAQSDIDSDSSPS
STPRKRGKFTPRGSKLRSQLSLTEDIAISIESEPRVPSSNLALSAQEAGDSGKSSSAGDN
VESSGTDSESLTSITPQESQRSSASTAATSVFDEAVSLNTRPTKSAVTTAAPAESSIAAE
APLSTTIPETDIKLEVEPSCEPTTTVTAQLDTTVRADSCVSDISSSTKLEDGSEALEHVK
KPRKPRTKRVYLTIEPESKLNRVPGDYTKTPKLLAHSYDRWVDCHTCNAWFVQQNSYLTR
RECPRCERHSMLYGFRWPKTEKEGPNDDEERVMDHRTIHRFLYPEEEALVSRRGRGVSFG
LTPTPELSDMRSETPDSEALDERGNTRVTRRRTRAIRVTTV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcctcaaaggcccggtccagtccgtccgtggaccggcgcgaacgtctgacgctt
gcgaaactggccagctatgacgatgtcgcaacagatgcgctggttgactgtgcttatttt
tggaccaaaacccgcaaaaatcgaacgaaatatatccctgtccgcggcctggccgaagat
accgtggcccatatccttttacacgatgttatagtcgcgaaggatgtgagcgcagcagaa
cggaaaatactagatctaattggcatgaagagatacctggcaaaattacccaacgaccgc
gaaaaggactggttccgcaaacaccttcgcaaatatatacagatgtaccttcccgactgt
ccgtttgaggtcacgaccaccaatcgctacacaatcaccgaacatgaggccgctatttgc
gcccggaaatttatcccacaaggccaggagatcaagtacttgagcggaactttggtgccg
atgaccaaggaagaagagcgggatttggatttgaaaagaaaagattttagcatcgtgatg
tcgagccggaggaaaacaccgtcattcttcttgggtcctgcccgcttcgcgaatcatgac
tgcagcgccaacgggcgtctggtgactcgaggttcggaagggatgcaggtcgtcgccact
cgagacatctatatcggcgaggaaattacggtttcgtacggtgaagactattttgggatt
gacaactgcgaatgtctatgcctcagttgtgaacgcgttccccgcaacggatggtcacag
aacctagctcctgggccacaaagcaaaccgtctacgccagaaccaaaggctagtgaagac
caccttacgccgaggaaacgcaaggcccaatcagatatcgattcggacagctccccctct
tcaactcctaggaagcggggaaagttcacaccacgtggttccaaactgcggtctcagttg
tctcttaccgaagatattgctatctcaattgagtccgagcctcgtgttccatcgtcgaat
ctggccttgtcggcgcaagaggccggcgattccggaaagagcagttcagccggagataat
gtggaatcttcggggaccgattctgaatctcttacctccataacccctcaagaatcacag
cgatcatcggcatccactgctgcaacttcagtgttcgatgaagccgtatcactcaatacg
aggccaaccaaatctgcggtaacaactgcggcgccggcagaaagttcaatagcggccgag
gcgcctttatctacgacaatccctgaaactgatatcaaacttgaggtggaaccttcttgc
gaacccaccactactgtaacggcacaattagacactacggtgcgcgctgatagctgtgta
agcgatatctcaagttctaccaagttagaagacggatcagaagctctggagcacgtgaag
aaacctagaaaacccagaaccaagagggtctatttgaccattgagccggagtcaaaactg
aatcgagttcctggagattacaccaaaacaccaaaactactagcgcactcgtatgaccgc
tgggtagactgccacacttgcaacgcttggttcgtacaacaaaactcctatctaacccgg
agagagtgccctcgctgcgagcgccactccatgctgtatgggttccgctggccgaagacc
gagaaagagggcccgaacgatgatgaggagagagtcatggaccatcgcaccatccatcgg
ttcctgtaccccgaggaagaggcccttgtatctcgcaggggccgtggggtcagtttcggc
ctcacccccaccccggagctgtctgatatgcgcagcgagactcctgatagcgaggctctc
gacgaacgaggcaatacgcgagtgactagacggcgcactagagctatccgagtaactact
gtgtaa

DBGET integrated database retrieval system