KEGG   Aspergillus nidulans: AN6207.2Help
Entry
AN6207.2          CDS       T01016                                 

Definition
similar to related to pyruvate dehydrogenase kinase isoform 2, mitochondrial
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     AN6207.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   AN6207.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 405 aa AA seqDB search
MWKPSERLMDTIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKKVQDWYAQSFEILAETTQNPSVREGQYRSAMTNGNGNGKAAAAA
RRYFVPSDDQGNWPPELNDYNERFAKTLQQIKRRHDSVVTTVAQGILEWKRKRQRLQIDS
TIQSFLDRFYMSRIGIRMLIGQHIALTEQTHVRHPNYVGIICTKTNVREVALEAIENARF
VCEDYYGLFEAPKVQLVCKEDLNFMYVPGHLSHMLFETLKNSLRAVVERHGADKEAFPVT
KVIIAEGKEDITIKVSDEGGGIPRSAIPLVWTYMYTTVEQTPNLDPDFDKSDFKAPMAGF
GYGLPISRLYARYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagccgtcggagcgcctgatggacaccatcaggcattacgccagctttccagca
actggtgtttcgctccgacagatggttcagtttggagacagaccttcaactggaactctg
tttcgcgcctcccaatttctgtcagaagaactcccaatccgcctagcgcaccgtgtccag
gatcttggagagcttcccgatggactcagtgaaatgccctccatcaagaaggtccaggat
tggtatgcacagtcgttcgagattctcgccgaaacaacacaaaatccaagtgtccgcgag
ggacagtatcgctccgctatgacaaacggtaatggaaatggcaaggctgctgctgctgca
cgaagatattttgtcccttcggatgaccagggaaactggcctcccgagttaaatgattac
aacgaacggtttgcaaagactctacaacaaattaagcggcgacacgacagtgttgtgact
acagtggcccaaggtattctggaatggaaacgaaagcggcagcgtctgcaaatcgactcg
acaatccaatcatttctcgatcgcttctacatgtctcgcataggtatacgaatgttaatt
ggccaacacattgctctcacggaacaaacgcacgtgcgccatccgaattatgtcgggatc
atatgtaccaagacaaatgtgcgcgaggtggccctcgaggccattgagaacgctcggttt
gtgtgcgaggattactatggtctatttgaagccccaaaggtccagctcgtgtgcaaagag
gatctgaactttatgtacgtgccgggacatttgtctcacatgctttttgagacattgaag
aactccctgcgcgccgtggtcgagagacacggcgcagataaggaagctttccccgtcacc
aaggtcatcatcgccgaaggcaaagaggatattactatcaaggtgtccgatgaaggtggt
ggcattccgcggtctgcgatccctcttgtctggacctatatgtataccacagtggagcaa
acacccaacctcgacccggactttgacaagagcgacttcaaagcgcctatggcaggattt
ggatatggtttgcccattagtcgcctgtatgcgcgatactttggcggtgacttgaagtta
atcagtatggaagggtacgggacggacgtctaccttcaccttaaccgcctatcatcgagt
tcggaacccctccaatga

DBGET integrated database retrieval system