KEGG   Aspergillus nidulans: AN6209.2Help
Entry
AN6209.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
ani  Aspergillus nidulans
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ani00230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ani00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 489 aa AA seqDB search
MSSSNDVYQTPLNSRYASDEMKYLFSPRNRFSTWRQLWLWLAEAEKELGLPITDEAIEQM
RKHTTINDEEFKVAAEEEKRRRHDVMAHVHAYGQVAPAAAGIIHWGATSCYCTDNADLIF
LRDGLNILIPKLAVVIDKLSAFAKQYKDLPCLGFTHGQPAQLVTVGKRACLWIQDLLMDL
RNLERARDDLRFRGVKGTTGTQASFLQIFNGDHDKVEQLDELVTKKAGFDSAFIISSQTY
SRKIDVDVANALGSFGSTCERIGIDIRHLAMLKEVEEPFEKDQIGSSAMAYKRNPMRSER
LCSLGRHLQNLPKDALDTYSAQWFERSLLLMADKDDSAIRRISIPELYLCADACLILLNN
VTSGFVVYPEVIKRRVNDELPFMATENVIMACVKKGLSRQDAHEEIRVLSHQASDNVKKH
GKNNDLLDRIRRTEFFAPILGELDALLDPSTFVGRAPQQVEKFTSTEVKKALQPYETYLA
TAETSALHV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaagcaatgatgtgtaccagacgcctctcaactcgcgatatgcaagtgatgag
atgaagtatctcttctctcccaggaataggttctctacatggagacagttgtggctgtgg
cttgcagaggctgagaaagagcttggcttgcccatcaccgatgaagccattgagcagatg
cggaaacacaccacgatcaatgacgaagagttcaaggttgctgctgaggaggagaagcgc
cgaagacacgatgtcatggcccatgtccacgcttacggccaagttgcccccgcagctgct
ggaatcatccactggggtgcgacttcctgttactgcactgataatgccgacctgatattc
ctgcgtgatggcctgaacatcctcattcccaagttggcggttgtcatcgataagctgtct
gcctttgctaagcagtacaaggatctgccctgccttggtttcacccatggacagcctgca
cagctcgtcactgttggaaaacgtgcgtgcctgtggattcaagacttgctgatggatctg
agaaacctcgaaagggcgcgcgatgatctgcgtttccgtggtgtcaagggcacaacgggt
acacaggcgtcgtttcttcaaattttcaacggagatcacgacaaggtcgagcaattggat
gaactcgttactaagaaggccggctttgattctgctttcatcatctcaagtcaaacttac
tctcgcaagatcgatgttgacgtagctaacgccttgggctcctttggttccacctgcgag
cgcattggtattgatatccgccacttggccatgctcaaggaggttgaggaaccctttgag
aaggatcagattggcagcagtgcgatggcttacaagcgaaaccctatgcggtccgagcgc
ctgtgctcgctgggcaggcaccttcagaacctccccaaggacgccctggacacctactcc
gctcagtggtttgaacgttcattgctactaatggccgataaggatgacagcgccatccgc
cggatcagtatccccgagctttacctctgcgctgacgcgtgcctcatcctcttgaacaac
gtaacttccggattcgtggtgtaccctgaagtcatcaagcgccgtgtgaacgatgagctt
ccatttatggcaactgagaacgttatcatggcctgcgtgaagaagggactttcccgccag
gacgcccatgaggaaattcgtgtcctctcacaccaagcctccgacaacgttaagaagcac
ggcaagaataacgacctcctcgaccgcatccgccgcaccgagttcttcgcgcctatcctc
ggcgagctcgacgctctcctcgaccccagcacctttgtcggccgtgcccctcaacaggtc
gagaaattcacctcgaccgaggtcaagaaggccctgcagccctacgagacttatctcgct
actgccgagacctctgcgcttcacgtttaa

DBGET integrated database retrieval system