KEGG   Aspergillus nidulans: AN6231.2Help
Entry
AN6231.2          CDS       T01016                                 

Definition
(RefSeq) similar to AF207903_2 bifunctional tryptophan synthase TRPB
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ani  Aspergillus nidulans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AN6231.2
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AN6231.2
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AN6231.2
Enzymes [BR:ani01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AN6231.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 723 aa AA seqDB search
MEHIKNTFEKVKREKRAALVAYITAGYPTIEESVDILLGLENGGADIIELGVPFTDPIAD
GPTIQKANTKALANGVTVSTVLEMVRSARNRGLKAPIMLMGYYNPMLSYGEERMLRDCKE
VGVNGFIMVDLPPEEAVRFRDLCTSTGLSYVPLIAPATSESRMKLLCKIADSFIYVVSRM
GVTGATGTLSSNIPELLARVHKWSGNVPTALGFGVSTREHFLSVQEISEGVVIGSQIITV
LGEAPAGQAAQKAEEYLSSVTGRKLERDTSGALTREVNVLEPVLKIETPPMSQPTDVITE
KDTPSGPGLGDQLEALNGGGSSSATPARFGEFGGQYVPESLMDCLAELERGFDSALKDPS
FWEEYRSYYPYMGRPSSLHLATRLTEHVGGANIWLKREDLNHTGSHKINNALGQILLARR
LGKTRIIAETGAGQHGVATATVCAKFGMKCVVYMGAEDVRRQALNVFRMKLLGASVVAVD
AGSRTLRDAVNEALRAWVVDLDTTHYIIGSAIGPHPFPTIVRTFQSVIGEETKQQLQEQI
GKLPDAVVACVGGGSNAVGSFYPFSKDTSVKLLGVEAGGDGIDTNRHSATLSGGSKGVLH
GVRTYILQDEHGQVSETHSISAGLDYPGVGPELSNWKDSDRAHFIAATDAQALSGFRTMA
QTEGIIPALESSHAIWGAIELAKTMGKGKDIVLTVSGRGDKDVESVAESLPKLGPQIGWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatcaaaaacactttcgagaaggtcaaacgggagaagcgtgccgctctcgtc
gcctacatcaccgccggatatcccacaatcgaagaatctgtagatatccttcttggattg
gaaaatggaggtgctgatattattgaactgggtgttccattcaccgatcctattgctgat
ggaccgaccatccaaaaagctaacactaaggctcttgccaatggtgtcacggtctcgaca
gtactggagatggtccgctccgcgaggaatcgaggcctcaaggctcctattatgctgatg
ggatactataaccccatgctcagctatggcgaagaacgtatgctccgggactgcaaggag
gttggcgtcaatggtttcatcatggtcgatcttcccccagaggaggccgttcgcttcaga
gatctttgcaccagtacaggtctttcttatgtcccactaatcgctcccgctacctccgag
tctcgcatgaaactcctttgcaagattgccgattccttcatctacgtcgtctcaagaatg
ggtgtgaccggtgctaccgggacccttagctcgaacatccccgaactgctcgctcgtgtc
cacaaatggtccgggaacgtgccaacagcgcttggtttcggtgtcagcacccgcgagcac
ttcctttctgttcaggagatttctgaaggtgtcgtcatcggtagccagattatcaccgtt
cttggagaagcccctgcaggtcaggcggctcaaaaagcggaggagtacttgtctagtgtt
actggccgcaaactagaaagggatacctcgggagcgttgactcgtgaggtgaacgtgctg
gagcctgttttgaagatcgaaacccctcctatgtcacagcctactgatgtcattacggag
aaggatacgccttcgggtcctggtcttggagaccaacttgaggctctgaacggtggtgga
agttctagcgcaacacctgcacgtttcggcgaattcggtggacagtatgtccccgagtct
ttgatggattgtctggccgagttggagcgaggcttcgatagcgccctcaaggacccttca
ttttgggaggaatatcgctcatactatccttacatgggacgccccagtagccttcacctc
gcaacccgtctgactgagcatgtgggaggtgccaatatctggctgaagcgtgaggatctc
aaccacaccggtagtcacaagatcaacaatgctctgggtcagattctgcttgctcgaaga
ctcggaaagacaagaatcatcgcagagactggtgcaggtcaacacggtgttgccactgcg
actgtttgcgctaagtttggcatgaagtgtgttgtctacatgggtgcagaggatgtgcgt
cgtcaggccctgaatgttttccgtatgaagctccttggcgcgtccgtggtcgccgttgat
gcaggcagtcgaactctgcgtgacgctgtgaacgaggctttgcgtgcgtgggttgttgac
cttgatacgacccactacatcatcggctctgctatcggtcctcatccattcccaacgatc
gtgcgcactttccagtcagttatcggtgaagagaccaaacagcaactgcaagaacagatt
ggaaagttgcctgacgccgtcgtcgcctgtgttggtggtggtagcaacgctgtcggcagc
ttctacccattctccaaggatactagcgtcaagcttcttggtgtcgaagccggtggtgac
ggtatcgacacaaatcgccactccgccaccctctccggcggtagcaagggtgttcttcac
ggtgtccgcacctacatcctgcaagacgagcacggccaggtctctgagacgcactccatt
tccgctggtcttgactatcccggcgttggccccgagctcagcaattggaaagacagcgac
cgcgcgcactttattgccgctacggacgcccaggctctctctggcttccgcaccatggct
cagacagaaggtatcatcccagctcttgagtcctcgcacgccatttggggtgctatcgag
cttgccaagaccatgggaaagggtaaggacatcgttcttactgttagtggtagaggtgat
aaagacgttgaaagtgttgccgagtctcttcccaagttaggtcctcagattggctgggat
ttgcggttctaa

DBGET integrated database retrieval system