KEGG   Aspergillus nidulans: AN6246.2Help
Entry
AN6246.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ani  Aspergillus nidulans
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 2870834
NCBI-ProteinID: XP_663850
UniProt: P38091
Position
I
AA seq 144 aa AA seqDB search
MFFPGDSTKGAKLFETRCKQCHTVENGGGHKVGPNLHGLFGRKTGQAEGYAYTDANKQAD
VTWDENSLFKYLENPKKFIPGTKMAFGGLKKTKERNDLITYVTLLTTDRAHRLTGCTATS
RRALLKSFAIRRDKPPPGDRRASG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttgttttttccaggcgactctaccaagggtgctaagctcttcgagacccgttgcaagcag
tgccacactgtcgagaacggcggcggccacaaggtcggccccaacctccacggtctcttc
ggccgtaagactggtcaggctgagggctacgcctacaccgatgccaacaagcaggccgac
gtcacctgggacgagaactctctgttcaagtacctcgagaaccccaagaagttcatcccc
ggtaccaagatggctttcggtggtctcaagaagaccaaggagaggaacgatctcatcacg
tatgtaacgctgcttaccacggatagggcacataggctaacaggatgcacagctacctca
aggagagcactgcttaaatcgttcgcgattagacgagataaaccgccccctggggatcgc
cgggcctctggctag

DBGET integrated database retrieval system