KEGG   Aspergillus nidulans: AN6246.2Help
Entry
AN6246.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ani  Aspergillus nidulans
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ani00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 144 aa AA seqDB search
MFFPGDSTKGAKLFETRCKQCHTVENGGGHKVGPNLHGLFGRKTGQAEGYAYTDANKQAD
VTWDENSLFKYLENPKKFIPGTKMAFGGLKKTKERNDLITYVTLLTTDRAHRLTGCTATS
RRALLKSFAIRRDKPPPGDRRASG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttgttttttccaggcgactctaccaagggtgctaagctcttcgagacccgttgcaagcag
tgccacactgtcgagaacggcggcggccacaaggtcggccccaacctccacggtctcttc
ggccgtaagactggtcaggctgagggctacgcctacaccgatgccaacaagcaggccgac
gtcacctgggacgagaactctctgttcaagtacctcgagaaccccaagaagttcatcccc
ggtaccaagatggctttcggtggtctcaagaagaccaaggagaggaacgatctcatcacg
tatgtaacgctgcttaccacggatagggcacataggctaacaggatgcacagctacctca
aggagagcactgcttaaatcgttcgcgattagacgagataaaccgccccctggggatcgc
cgggcctctggctag

DBGET integrated database retrieval system