KEGG   Aspergillus nidulans: AN6305.2Help
Entry
AN6305.2          CDS       T01016                                 

Definition
similar to AF262987_1 cAMP-dependent protein kinase PKAC catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ani  Aspergillus nidulans
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ani04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 472 aa AA seqDB search
MPTLGGLLKKRRTRDSQDLSKELQAGSTTTGHTTTSPIAAEDSQSQQHHGHHGGHHFFHH
NHHNHQPSNNSANSANSQNSHAAKHHQFDQSSATSNQPSDGQTASMQSPAQQPSSTSAHS
NSGHHSNAASIHNIIHPSQQNTPQVSRAERTTKGKYTLDDFAIQRTLGTGSFGRVHLVQS
KHNHRYYAIKVLKKAQVVKMKQIEHTNDERRMLNRVRHPFLVTLWGTWQDARNLYMVMDF
VEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSLNIIYRDLKPENLLLDRHGHLKI
TDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIFEMLCGFTPFWDQG
SPVKIYQNILAGRIKFPPYLHPDAVDLLSRLITSDLTKRLGNLHGGPDDIKNHPWFAEVT
WDRLLRKEIDAPYVPPIRGGQGDASQYENYQEESEPYGQAGEDPHGHLFPDF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcctactctaggaggtcttttgaagaaacggcgaacgagggattcgcaagacctctcc
aaggagctccaggccggttccaccacgactggccacaccacgacgtcaccaatcgctgcc
gaagactcccagtcccagcagcaccacggccaccacggcggccaccatttcttccaccat
aaccaccataaccaccagccttctaacaattcggctaattcggcgaattcgcagaattcc
cacgccgctaaacaccaccaattcgaccagtcttcagctaccagtaaccagccttccgac
gggcaaaccgcctccatgcaatcccccgcacaacagccctctagtacttccgcacactcg
aattccggccaccacagcaatgccgccagcatacacaacatcatacacccgtcgcagcag
aataccccgcaggtgtcgcgggcggagcgtaccaccaagggcaaatacaccctcgatgat
ttcgcaatccagcgcaccctcggcacaggtagttttgggcgcgtccacctcgtgcagtcg
aagcacaaccaccgctactatgccatcaaagtattgaaaaaggcgcaagttgtcaagatg
aagcagattgagcatacgaatgatgagcgacggatgctgaaccgcgtcaggcatcctttc
ctggtcaccctgtgggggacttggcaggatgctcgaaacctctacatggttatggacttc
gtcgagggtggagagttgttcagtctgcttcggaaatctcagcggttccccaaccctgtc
gcgaaattctatgctgccgaggtcactctggcactggagtatctccactcattgaatatt
atttatcgagatcttaagcctgagaacttgttgttagaccgccatgggcatctcaagatt
accgatttcggctttgcgaaggaggtgcctgacattacctggaccctttgcggaacacct
gactatctcgctccagaggtcgtggcttctaagggttacaacaaatctgtcgactggtgg
tccctaggtattctgatcttcgagatgctgtgcgggtttacacccttctgggaccaaggg
tcgcctgtcaagatatatcagaacatccttgctgggagaatcaagttcccaccatacctc
caccccgatgccgtcgatctgctctcccgcctgatcacctcggatcttaccaagcggttg
ggtaacctccacggtggccccgacgacatcaagaaccacccatggttcgcggaagtcact
tgggaccggttgttgaggaaggagattgacgcaccttacgttcccccgatcaggggcgga
caaggtgatgccagccagtacgagaactaccaggaagagtcagaaccctacggccaggcc
ggcgaggatccccacggtcacctgttccccgatttctag

DBGET integrated database retrieval system