KEGG   Aspergillus nidulans: AN6402.2Help
Entry
AN6402.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ani  Aspergillus nidulans
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AN6402.2
Enzymes [BR:ani01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     AN6402.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AN6402.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 816 aa AA seqDB search
MPEAVSQTVKRGAFDPSKAYAAQEGTTFFNDGREIELLHFVYSHPKLDSIRGSPESVLDA
IDEYARTRKYLMNVGEDKGRIVCDLIAEVKPKTMVELGGYVGYSSILFGAAVRAAGGSRY
YSLEMNPEFAAVIMALVDLAGLSDVVKVVIGPSDVSIARLYESAALTHIGLLFLDHYKPA
YTTDLKLCEELKLITPGSVLAADNVIKPGNPPYLEYVRRSVDEKRKHLGVSTNGGGLPGK
TVDQYKDKTGFGQMKLSQSRGNPNLIYESRLVESFEPTGVPQCGRAYENHGTPGAAGMPW
PHSLTQHLILLLHKAEFRIPSSKMAEPFFYSHIPKNILLILLSLMFLPTTAIIAITSLVI
NYVSKTPEQGRFKESSAPKTILVTGVSMAKGLAIARLLARETPHRIIGADTEPLLFTSPG
RYSQSIVKFYRLSSPRPGDPKPYLDSLLSVMRKEEVHLWISCSSVIGAVEDGEVMVMAEK
EFGKDRFKAVQFDSETVKRFHEKDTFIDYIKSLELPVPESYRCTSVEEVTILLNQGREKA
KRFIMKPIGVNDKARGKMMTLLPLDSEEATSSYLTALDISKSSPFLLQEYITGEEYCTHS
LVVRGDVKAFVACPSSDMLMHYSATPPGSALSMKMLEFTTRVAERGGEDFTGHLSFDFLV
QGRGEEARLSPIECNPRTHTAVILFQHTPEVAHAYLSVFGHNLDSKLKQDKGSSDIVAPA
TPDYNVYWIGHDLVTLLIIPVVTWIGGIRSTEETKHSLRTFWHHLLHWRDGTWALWDPVP
FFALYHVYWPARFVECIFKNRKWSRINVSTTKMFEC
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagcagtatctcaaacagtaaaaaggggggcatttgacccctctaaggcctat
gcagcacaagaaggaaccacattcttcaacgatggccgtgaaatcgagctccttcatttt
gtttactcgcaccccaaactggacagcattcgaggatcgccggagagtgtccttgacgcc
atcgacgagtatgctcggacaagaaagtacctgatgaatgtcggtgaggataaggggagg
atcgtgtgtgacttgattgcggaggtgaaaccaaagacaatggttgaactaggcggctat
gtcggttactccagcatccttttcggggccgcagttcgcgccgccggtggaagtcggtat
tacagtttagaaatgaaccccgaattcgcggcggtgattatggccctcgtcgacctggca
gggttatcggatgtcgtgaaagtggttattggaccaagcgatgtatcgatcgcgcgtctc
tacgaatcagccgcactaacgcatatcggcctgctgtttctagaccactataagcctgca
tacacgactgacctgaagctctgcgaggaattgaaactgatcactcctggctccgtttta
gccgcggataatgtgatcaagcccgggaacccgccgtatcttgagtatgtacgacggagt
gtggacgagaagaggaagcatctgggggtgtcgacgaatggtggtggtttgcccgggaag
acggtagaccaatacaaggataaaactggttttgggcagatgaagcttagccagagccgt
gggaatccaaatctcatctatgagagtcggttggtggagagttttgagccgacgggggtg
ccgcagtgtgggcgtgcatatgagaaccatggaacacccggagccgccggtatgccctgg
cctcacagtcttacccagcacctcatcctcctgttgcacaaggctgagtttaggatacca
tcaagcaagatggcggagccgtttttctacagccatataccgaaaaacattctcctcatt
ttgctcagtctaatgttcctacctacaactgctataatagccatcactagcctcgtcatc
aactatgtatccaagacgccggaacaaggaaggttcaaagaatcttctgcaccgaagacg
atcctagtgaccggagtctctatggccaagggccttgccatcgctcggctcttggcgagg
gagacgccgcaccgcatcatcggcgccgacacggagcctctactcttcacctcgccaggc
cggtattctcaatcaattgtcaaattctacagactctcgtcgccccgtccaggtgatcca
aagccttacctcgactctctcctctccgtgatgagaaaggaggaagtgcatctatggatc
agttgtagcagtgttattggtgccgttgaagacggcgaggttatggtaatggcggagaag
gagttcggaaaagatcgtttcaaggctgtccagtttgattcggaaaccgtgaagagattc
cacgagaaggatacatttattgactacatcaagagcctggaactgcctgtacccgagtca
tatcgatgcacatcagttgaagaggtgacaattttactcaaccaaggtagagaaaaagcg
aagaggttcattatgaaaccaatcggagtgaacgacaaggcgagagggaaaatgatgact
ttgctccccctcgacagcgaggaagctacatcctcctatcttactgcgttagatatctcc
aagtcttcccccttcctcttacaagaatacattaccggtgaggagtattgcacgcattcg
ctcgttgtgcgtggggatgtcaaggcgttcgtggcatgtccgtcgtctgacatgcttatg
cattacagcgccacacctccaggctcggccctgagtatgaagatgctcgagttcacgacc
cgagtcgcagagcgtggcggggaggacttcacggggcatctaagttttgatttcttggtg
caaggtcgaggggaagaagcaaggttatccccaatcgaatgcaacccgcgcacacacact
gcagtcattttattccaacatacacctgaagtggcacatgcgtatctatctgtcttcggt
cacaacctggactcgaaactgaagcaggacaaaggctcgagcgacatcgtggcccctgca
acgccagattataacgtctactggattgggcacgatctagtaactctgctcattatcccg
gttgtgacatggataggtggaatcagaagtactgaagagaccaagcactccctccggacc
ttctggcatcatctcctccactggagggacggcacctgggccttatgggatccggtgccc
ttttttgcgctatatcatgtctactggcccgcgcggtttgttgaatgcattttcaagaac
cgcaaatggtctcggatcaatgttagtactacgaagatgttcgaatgttga

DBGET integrated database retrieval system