KEGG   Aspergillus nidulans: AN6566.2Help
Entry
AN6566.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ani  Aspergillus nidulans
Brite
Protein phosphatases and associated proteins [BR:ani01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AN6566.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg Anthrax-tox_M EF-hand_9
Motif
Other DBs
NCBI-GeneID: 2870688
NCBI-ProteinID: XP_664170
UniProt: Q5AYR4
Position
I
AA seq 154 aa AA seqDB search
MGRGSKSDNSGTIDRDEFLSLPQVSTNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSK
GNKEEKLRFAFKVYDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDHD
GKISFEEFTDMVESTDVNLSMTLNADVIDSRPII
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgggtagggggtcgaaatcagacaactccggcacaatcgatcgcgacgaattcctctcc
cttccacaagtctcaactaacccccttgctacaagaatgatcgcaatattcgacgaagac
ggcggcggtgacgtcgacttccaagagttcgtctcgggcttatccgctttcagctcaaag
ggcaacaaggaagagaagctgcggttcgcattcaaggtctacgacatcgatcgcgacggg
tacatatccaatggcgagttgttcatcgtgctgaagatgatggtcggcaataatctgaag
gatgtgcagctacaacagattgttgacaagacaatcatggaggctgataaagatcacgat
ggcaagatcagctttgaggagtttacagatatggtggagagcacggatgttaatttgagt
atgactttaaatgcggatgttatcgattcacgtcctattatctga

DBGET integrated database retrieval system